KEGG   Schizosaccharomyces pombe (fission yeast): SPBC216.07cHelp
Entry
SPBC216.07c       CDS       T00076                                 

Gene name
tor2, SPBC646.01c
Definition
(RefSeq) phosphatidylinositol kinase Tor2 (EC:2.7.1.137)
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Regulation of mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 Cellular Processes
  Transport and catabolism
   04139 Regulation of mitophagy - yeast
    SPBC216.07c (tor2)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SPBC216.07c (tor2)
Protein kinases [BR:spo01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   SPBC216.07c (tor2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(915271..922284)
Genome map
AA seq 2337 aa AA seqDB search
MKEFPGLKSRNEEIRNKAANDLYEYVIAYSRELSGEALVQFNNDVNKYVYTLIHSTDPLD
RLAGVTAINRLIDYEGEDTTRITRFANYLRIILPGTDQKATVLAAKALGRLAVPGGALTS
EFVNFEVKRALEWLQGERNENRRYAAVLILKELAKNTSTLIYAHIDSIFELLWHGLRDPK
VTIRIASADALSEFLKIVRQRDSSIRLQWYTSILNEAQRGVAQGSSDYIHGSLLVYRQLF
LKAGMFMHERYREVSDIILQFRDHKDLLIRKTVTELIATLAAYNPDEFVSNYLHVCMLHL
LNLLKKENVKMLAFATIGKVAVAITNSIIPYLDPICDSIKESLKIHIRNKSASDAAIFQC
ISLLSIALGQAFSNYAYDLFDLIFASGLSEASYRALSDLAHNIPPLLPVIQERLLDMLSK
ILSGRPFIPPGCPPQYVARSLKSSKSASLKTGFFPNDVYILALKVLGNFDFSGYILNEFV
KDCVVVYLENNDPEVRKTASITCSQLFARDPILSQTSDHAIQVVAEVLEKLLTVGICDTV
PDIRLTVLNSLDSRFNKHLAQADKIRLLFIAINDENFAVRESALRIIGRLNVYNPAYVMP
YLRKIMLKTLTILDYSTIIRTKEENAKLLCLLIAAAPRLIESHVEPILQILLPKAKDSSS
IVAASIVNSLGEICQISGEVIVPFIKDLMPLIIEALQDQSSPIRRAAALKALGNLSSSTG
YVIDPYIEFPSLLDILIGITKTEQDITIRRETIKLIGTLGALDPNRHRVLEKGTEKVVPE
QKNIPPDISLLMSGIGPSSDEYYPTVVITALMSILKDPSLTIHHTAVIQAVMYIFKTMGL
RCAPFLSQIIPEFIAVMRTCPTNILEFYFQQLSILVLIVRQHIRSFLPDLFKLIKDFWNP
HSNLQFTILSLIESLARAMQGEFKPYLPSLLVMMLQIFDSDVSVDSVSTKKVLHAFIVFG
DTLADYFHMLLDPILRLYERNDVSIGIKESIMITIGRLSMVINLSEYASRIIHPVMRMLS
CNNASLIRVSMDTVCALIYQLNVDFAIFIPMIDKCLKMNGVTHETYSILVEQFLQEQPLP
IKLNPYEKYDKPKLDVVASAADITSKKLPVNQEILRNAWEASQRSTKDDWQEWIRRLGVA
LLRESPSHALRACAALAAAYQPLARDLFNASFVSCWSELYDHFQEELVKSIEIALTSPHI
SPEIIQILLNLAEFMEHDDKPLPIDIRTLGAYAAKCHAFAKALHYKELEFIEEELVTKPS
VDTIEALISINNQLQQPDAAIGILKHAQQHDKMNLKETWYEKLQRWEDALSAYEKREAAG
AGNFEITMGKLRCLHALGEWDRLSQLAQENWIHAGHDARRYIAPLSVAAAWGLGQWEQMD
EYISVMKSESPDKAFFNAIVALHRSQFEEAASYITRARDLLDTELTALVGESYNRAYSVA
VRVQMLSELEEIITYKKAEDKPEVREMIKKTWVRRLKGCQRNVDVWQRMLRIRSLVISPR
DNMEMWIKFANLCRKSGRISLAKKSLNLLLEDDENLDNSLVLKKTHPSIVYANLKFLWAV
DDKRKALNSMQEFTSQLISDINVDPALFVQSTSVNTQKSQEEIQYYFHLLARCYHKQGQW
QQEIENNWSEGSFDGVLQSYMYATQFDSKWYKAWHSWALANFEAVKFLEQSEEQIPSAAY
EQYIIPAVKGFFKSIALSKGNLQDTLRLLNLWFKFGNNSNVINTLNVGISTVNIDIWLDV
IPQLIARIHASSLSVRKSVHQLLSDVGRAHPQALVYPLTVAAKSQSSARQNAALAIMDSL
KTHSPRLVEQARLVSHELIRAAILWHEQWHEGLEEASRLYFGDHNIEGMFAVLRPLHEML
ERGPETLREISFQQAFGRDLVEARDCCIRFEQTGDISDLNQAWDLYYQVFKKIRKQLPQL
TTLDLQYVSPKLLHVHDLELAVPGTYVSGKPVIRIVKFYPTFNVITSKQRPRRLSIKGSD
GKDYQYVLKGHEDIRQDERVMQLFGLCNNLLLADPETFKRLLSIQRYPVIPLSPDSGLLG
WVLDSDTLHVLIRDYRESRKILLNIEHRLIIQMAPDYDRLTLLQKVEVFEYALLSTTGQD
LYRVLWLKSRSSEAWLNRRTNYSRTLAVMSMVGYILGLGDRHPSNLMLDRYTGNIIHIDF
GDCFEVAMHREKFPEKIPFRLTRMLVNAMEVSGIEGTFRITCEHVMRVLRTNKESVMAVL
EAFVYDPLINWRLAPAYSPSIDEKQSNEPNTLLGETIDGLHRKRLNEEGITLEERQKPEI
LNQRAITVLNRVSNKLTGRDFKPQQQLDVPSQVEKLILQATSIENLCLCYIGWCSFW
NT seq 7014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttcctgggttgaaaagcaggaatgaagaaattcgcaataaagcggcaaat
gatctttatgaatatgttatagcttattctcgagaattatcgggcgaagctttagttcag
tttaacaatgatgttaacaagtacgtttatactttaattcacagtaccgatccactcgat
cgtctggcaggcgtaactgccataaatcgtctaattgattatgaaggagaagatactaca
aggattactagatttgcaaattatttgcgtattattcttccaggaactgaccaaaaagcc
accgttcttgctgcaaaagctttagggagacttgcagttcctggaggtgctctaacttct
gaatttgtgaacttcgaagttaaacgcgctttggaatggcttcaaggagaacgtaatgaa
aatcgtagatatgcagcagtgcttatacttaaggagcttgccaaaaatacgtctacatta
atctatgctcatatcgattcaatttttgagcttttatggcatggacttcgggatccaaaa
gttactattcgaatagcttcggctgatgcgttgagtgagttcttgaaaatcgttaggcaa
agggattcatccatccgtctccaatggtatacaagtattctcaatgaagctcaacgtggt
gttgcacagggttcttctgattacattcatggtagtttactagtatatcgccaattattt
ttaaaagctggaatgtttatgcatgagaggtatcgagaagtatcggacattatattgcaa
ttcagagatcacaaagatttgcttattcgcaaaaccgttacagaattgattgctacactc
gcagcttataatccagatgaatttgtttccaattatttacacgtttgtatgctccatcta
cttaatctattaaaaaaagaaaatgttaagatgttggcgtttgccactattggaaaagtt
gccgtggctattactaatagcataatcccatatcttgaccccatatgcgattcaatcaag
gaaagtctaaaaatccatatccgtaataaaagtgcttcggatgctgcaatttttcaatgc
attagcctactttctatagcactaggacaagccttttcaaactatgcgtatgacctcttt
gacttaatatttgcaagcggactttctgaggcttcttaccgtgctctctcagatctggcc
cataatatacctccattattaccagtcatacaggaacgactattagatatgctcagcaaa
attctaagtggtcgtccttttattcctccaggatgtcctccccaatatgtagcaagatct
ttaaaatcttcaaagagtgcttccctgaagacaggattttttcccaatgacgtctatatt
ttggctctaaaagttttgggaaattttgacttctccggttatattcttaatgaatttgtg
aaggattgtgtagttgtataccttgaaaacaatgacccggaagtacgcaaaaccgcctcc
ataacctgctcccaactatttgctcgtgatcctattttatcgcagactagtgatcatgcg
attcaagtagttgccgaagtgctagaaaagcttctaacagttggtatttgcgatactgtt
ccagatattcggctaactgttcttaattctctcgattctcgctttaacaagcatttagcc
caagcagataaaattcgtttactttttattgctattaatgatgaaaactttgctgtacga
gaatctgcattacggataattggaagactaaatgtctataaccctgcctatgtgatgcca
tatttaaggaaaataatgttaaaaactttaacaatattggactattctacaattatcaga
actaaagaagagaatgccaagttattgtgtttattaattgcagcagctcctcgcttaata
gagtcacatgtggaaccaatactgcaaatacttttacccaaagctaaagattctagttca
attgtggcagctagtattgttaattcgcttggtgaaatatgccaaatcagcggtgaggtt
attgttccttttattaaagacttaatgccgctaataattgaggctttgcaggaccaaagt
tctcctattaggagagcagcggctttaaaggctttgggtaatttatcaagcagcaccgga
tatgtaattgatccgtatattgaattcccttctttacttgatatacttattggcataacg
aaaaccgaacaagatattactattcgtcgagagactattaaactaataggtacacttggt
gctttagatcccaataggcatcgtgttttagaaaagggaacagaaaaagtagttccagaa
cagaaaaacattcctcctgacatttctttgctgatgtcgggcattggtccatcatccgat
gaatattaccccacagtcgtgattactgctttgatgagtatattaaaagacccgtcctta
actattcaccatactgctgttattcaagctgtaatgtatatattcaagaccatgggtctc
agatgtgccccctttctttcccaaattattccagaatttatcgcagttatgagaacgtgt
cctacgaacatattggagttttattttcagcaactaagtattttggtccttattgttcgt
cagcacatacgaagttttttaccagatttatttaagcttatcaaagatttttggaacccg
cattctaatttacaatttacaattttgtcgctaattgaatcactggctagagcaatgcag
ggagagttcaagccatacttaccatctttattagtaatgatgctacaaatatttgactct
gatgtatcagtggactcagtcagtacaaaaaaggtattgcacgcattcatcgtcttcggt
gatacattagctgattattttcatatgctcttggatccaatacttcgactgtatgagcga
aatgatgtttcaatcggtataaaagaaagtataatgattacaattggacgactttcaatg
gttattaatctctcggaatatgcatcaagaattatacatcctgttatgcgtatgctttcg
tgcaacaatgcctctctcattcgcgtgagtatggatactgtatgtgcgcttatatatcaa
cttaatgttgattttgctattttcattccaatgattgataagtgccttaagatgaatggc
gttactcatgaaacctactcgatacttgttgaacaatttttacaagaacagcctcttcct
ataaaactcaacccttatgaaaaatacgataagcctaaattagatgtggtagcttccgct
gctgatataacctctaaaaagcttcctgtaaatcaagaaatcctcagaaatgcgtgggaa
gcatctcaacgatcgactaaggatgactggcaagaatggatccgacgattaggcgtagct
ctcttaagagaatcaccttcacatgccttacgagcatgtgctgctttggctgctgcctat
caacctttagccagggacttatttaacgctagttttgtttcttgttggtctgaattatat
gatcactttcaagaagaattagttaagtcgattgagatagctttaacgtcgccacacata
tctcctgaaattattcagattttactcaatcttgcggaatttatggagcatgatgataaa
ccacttccgattgatattcgtactttgggtgcctatgcagctaaatgccatgcgtttgct
aaggctttacattacaaggagctagaattcattgaagaagaattggtgacaaaaccttcg
gttgatacaattgaggccctaatttcaatcaataatcaactccaacaaccagacgcagct
attggaatacttaaacatgctcagcagcatgacaaaatgaatcttaaagaaacttggtac
gaaaagttacaaaggtgggaagatgctctgtcagcttatgaaaaaagagaagctgctggc
gctggcaatttcgaaataacgatgggcaaacttcgttgtttacacgctttgggtgaatgg
gatcgattatctcagttagctcaagaaaattggattcatgctggtcatgatgcgcgacgg
tatattgcaccgctttccgtagccgctgcttgggggttaggtcaatgggagcaaatggat
gaatatatttctgttatgaagtctgagtcaccagataaagctttttttaacgcgattgtg
gctctacatcgatcacaatttgaagaagcagcttcttatatcaccagagctcgagattta
cttgatactgagcttactgcgcttgttggtgaaagttataatagggcttacagcgttgct
gtccgtgttcaaatgttatccgaattagaagaaatcattacctataaaaaagccgaggac
aaacccgaagttcgtgaaatgataaagaagacatgggttagacgtttgaaaggctgtcag
agaaatgtggatgtttggcaaagaatgttaagaatacgatctttagttatttcaccccgt
gataacatggagatgtggatcaaattcgctaatctctgcagaaaatctggtaggatcagt
ctagcgaaaaaatcacttaatttactccttgaagacgacgaaaacttagataattcactc
gtcttaaagaagactcacccttcaattgtctatgcaaatctaaagtttttgtgggctgtt
gacgataaaaggaaggctcttaatagcatgcaagagtttacttctcagctaatttctgac
attaatgttgaccctgctctttttgttcaatctacatcagttaatactcaaaaatcacaa
gaagaaattcaatattattttcatcttctagctagatgttatcacaagcaaggtcaatgg
cagcaagaaattgagaataattggtcagaaggatcttttgatggagttcttcaatcatat
atgtatgctacgcaatttgattctaaatggtataaagcttggcactcttgggcattagct
aatttcgaagctgtaaagtttttggagcaatcagaggagcaaatcccaagtgctgcatat
gagcagtatattattccagcagtcaaaggcttttttaagtcaattgctttaagcaaaggt
aaccttcaggacaccttgcgccttcttaatctttggtttaaattcggcaataatagcaat
gtaattaatactttgaacgttggtatatccactgtgaacatcgatatctggctggacgtt
atacctcagcttattgcgagaattcatgcctcctctttgagtgttcgtaaatctgtgcat
cagttgctttccgatgtaggtcgcgcgcatccccaagctcttgtttatcctttaactgta
gcagcaaaatcgcagagttctgctaggcaaaacgctgctttagcaattatggattccttg
aaaacacatagtccacgtctagttgaacaagcaagacttgttagtcatgagcttatcaga
gctgcaatcctttggcatgaacaatggcatgaaggattggaagaggcttcacgattgtat
tttggtgatcataacattgagggtatgtttgccgtgttgagaccattgcatgaaatgttg
gaacgtggtccggaaacgcttcgtgaaatttctttccaacaagcctttggacgtgactta
gtcgaagcaagggattgttgtatccgttttgagcaaactggtgatatatcagacttaaat
caggcctgggacttatattaccaagttttcaagaaaattcgtaaacagctacctcagttg
acaacattagatttacaatacgtttctcctaaactcttacatgtacatgatcttgagtta
gctgttccgggaacatacgttagcgggaaacctgttataagaattgtaaagttttaccct
acattcaacgtgataacatctaagcaacgtccgagacgactgagtattaaaggcagtgat
ggaaaagattatcaatatgttttaaagggtcacgaggacatcagacaagatgaacgtgtt
atgcagctatttgggctttgtaacaatctgttactagctgacccggaaacttttaagcgc
ttactttcaatccaaaggtatccagtgattcctttatcaccggattcaggccttttaggc
tgggttttggatagcgatactttgcatgtcttaattcgtgactacagagaaagcagaaag
attttactcaacatagaacataggttgatcattcagatggctccagattacgatcgtctc
actctccttcagaaagttgaagtctttgaatatgccctacttagtactacggggcaggat
ttataccgcgttttatggctgaagagtcgtagctcagaagcttggcttaataggcgaact
aactattctcgtactcttgcggtgatgtcaatggtagggtacatcttaggtttgggcgat
cgtcatccttccaatttgatgctggacaggtatacaggtaatatcatccatatcgatttt
ggagattgttttgaagtagcaatgcatcgagaaaagtttcccgagaagattcctttccgc
cttacgcgaatgcttgttaacgcaatggaagttagtggtatagaggggacgttccggata
acatgcgaacatgttatgcgagttcttcgtactaataaggagtctgtgatggcagtttta
gaagctttcgtttacgatcctcttattaactggcgccttgctcctgcatattcaccttct
atcgatgaaaagcaatctaacgaacctaatacacttctcggtgagacaattgatggttta
caccggaaacgcttaaacgaagaaggaattacacttgaagaacgtcaaaaacccgagata
ctcaatcaaagagctataaccgttcttaatcgtgtgtccaataaacttactggtcgggat
ttcaaaccccaacagcaattggatgtaccaagtcaagtagagaagctgattttacaagca
acctctatagagaacctatgcttgtgctatattggctggtgtagtttctggtag

DBGET integrated database retrieval system