KEGG   Schizosaccharomyces pombe (fission yeast): SPBC25B2.11Help
Entry
SPBC25B2.11       CDS       T00076                                 

Gene name
pof2
Definition
F-box protein Pof2
Orthology
K03360  
F-box and leucine-rich repeat protein GRR1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Ubiquitin mediated proteolysis
Module
SCF-GRR1 complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPBC25B2.11 (pof2)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPBC25B2.11 (pof2)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    target recognizing subunit (F-box)
     SPBC25B2.11 (pof2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(2617862..2619052,2619089..2619228,2619276..2619336)
Genome map
AA seq 463 aa AA seqDB search
MRVPNEVCFNILSYLEADELRCKSTVCTSWRNFIIPTLWEKVVFQNEAQLNNFFDTLQYS
KDVSYYFRYLRKLNCSRVRKFLTDKHLMLMTLATGISRLNLSGCTRISEPLIGKLLYQNL
NLVTINFSNIFSLPANILEYISDNCPNLKALNIGNCGLVEDTGMVQIIKRCPYLNRLIIP
NCRKLTDVSLQILSEKEDLIELDISGCEGFHNADTLSRLVSRNRGLKELSMDGCTELSHF
ITFLNLNCELDAMRALSLNNLPDLKDSDIELITCKFSKLNSLFLSKCIGLTDSSLLSLTK
LSQSLTTLHLGHCYEITDIGVQCLLKSCKNITYIDFGGCLRLSDIAVSAIAKLPYLQRVG
LVKCICLTDLSVILLSGSFSRNLERVHLSYCIGLTAKSVSYLMYNCKTLKHLSVTGINSI
LCTELRSFSRPIPDGINPSQVPVFCAFTKVEIDLFREFIRNRI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgcctaatgaagtttgttttaatatattatcatatttggaagccgatgagcta
aggtgcaaatcgacagtttgtacttcatggaggaattttattatacccactttatgggaa
aaagtagtatttcaaaacgaagctcaattaaataacttttttgatactttacaatactcc
aaggatgtttcgtactatttcaggtatttgcgcaagctgaattgctctcgtgttaggaaa
tttcttaccgataaacatttaatgttaatgacattagcaacagggatttctcgtctgaat
ttgtctggatgtactcgcatttccgagcctcttattggtaaactgttgtatcagaatttg
aacttggttactataaacttcagtaatattttctctttaccggcgaatatacttgaatat
atttctgataattgccctaatttaaaagctttgaatattgggaattgtgggttagtagaa
gataccggtatggttcagataataaaacgttgtccgtacttaaatcggctcattataccg
aattgtcgaaagctgactgacgtctcattacaaatactttctgaaaaagaagacctgatt
gaattagatattagtggatgtgaaggctttcataatgcggatacgctgtctaggttggtc
tccagaaatcgaggtttgaaagaattatctatggatggttgcacagaattgtcacatttc
atcacttttttaaacttaaactgtgaattagatgcaatgagggcattaagtcttaacaat
ttaccagatttgaaagacagtgacatagaattgataacttgtaagttctcaaaattaaac
tctctatttctttccaaatgcattggattgactgattcgtcacttttaagcttaacaaag
ctttctcaatctttaacgactcttcatttgggacattgctatgagataaccgatattggt
gttcaatgtcttctaaagtcatgtaaaaatataacttacattgacttcggtggttgcctt
cgtttgagtgatatagcagtaagtgctattgctaagttgccatatcttcaaagagtaggt
ttggtcaaatgcatttgccttactgacctttctgtaatcttactaagtgggtctttttcc
agaaaccttgaacgagtacatctttcttattgcattggactaaccgcaaagtcggttagt
tatttgatgtataactgtaaaacgttaaagcatcttagcgttactggaattaactctata
ttatgcacagaattgcgatctttttcccgtccaattccagatggaataaacccgtcccaa
gtcccggtattctgtgcgttcactaaggtcgagattgatttgtttcgagaatttattcgt
aatagaatatag

DBGET integrated database retrieval system