KEGG   Schizosaccharomyces pombe (fission yeast): SPBC29A10.01Help
Entry
SPBC29A10.01      CDS       T00076                                 

Gene name
ccr1, SPBC365.17
Definition
NADPH-cytochrome p450 reductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SPBC29A10.01 (ccr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:2533463..2535499
Genome map
AA seq 678 aa AA seqDB search
MKTYEYVLLVIILILSLCYFIYNNFLNKPKAPERRVVATDSIVELMEAEKLTAAVFFGSQ
TGTAEDFAYRFSTEAKANFNLTNMVFDLENYDLTDLDNFDRSKLLVFFLATYGEGEPTDN
AEAFLQLLEGDDTVFSSGKGIEDTPFEGIRYAIFGLGNHTYEYYNAMAKKVDAAMTRLGA
TRVGNLGLGDDAAGMLEEDYLQWKDDTLPEIGKLFHLQEVHKEYNPMFEVIEKPEISNTS
STVFLGEPSRQQLKGNVASKAPRSQANPFFSSPVRSLELFKSGSRNCLHLELDIADSGMR
YQTGDYASICPMNPSQAVDDLLEVLGLKEKRDTVIIVKPIDTLDKAPVLSPTTYDTVFRY
YYEICGIVSRQLLSFIAPFAPTPESKQELEKLGNDYDYFKKNVVDLHLNLAQVLRRVSPD
APFTKLPFSMLLENMAHMKPRYYSISSSSVVHPDKVHVTAVVDKKEWTDKNHIFYGLTTN
YLLAHCRHMHGEKIPHPNGLEYTLEGPRKNWTGKIPMFVKKSTFRLAPPDVPIIMVGPGT
GVAPFRGFVMERANLASKGVKVAKTLLFYGCQYSDKDFLYKEEWQQYKDVLKDSFELITA
FSREQDHKIYVQHRLLEHSDTIAKLVEEGAAFYICGDADHMAKDVVNALASILTTVDVDG
MKAVKALRDDNRFFEDTW
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttatgaatatgtattgctggtcattattttgatccttagcttgtgttacttt
atttataacaattttctcaacaagccaaaggctcctgagaggcgagtcgtggctaccgac
agtattgtcgagttgatggaggccgaaaagctcactgccgcggttttctttggatctcaa
actggtaccgctgaggactttgcctaccgtttttcaacggaagcaaaggcaaacttcaat
cttaccaatatggttttcgatcttgagaactatgatttaaccgacttggacaactttgat
agatcaaaactattggtattctttctcgcaacttacggtgaaggtgaacctacggacaat
gcggaggcctttttgcaacttcttgagggcgatgataccgttttttcaagtggaaaaggc
attgaagatactcccttcgaaggaattcgttatgcaatttttggccttggaaatcatacc
tatgagtattataacgcaatggctaaaaaggtagatgctgcaatgactcgtttaggcgct
actcgtgtgggcaatctaggtttgggcgacgatgccgctggtatgcttgaagaggactat
ttacaatggaaggatgatactttacctgagataggtaagctgttccatttgcaagaagtc
cacaaggaatacaatcctatgtttgaagttattgagaagcctgaaatttccaacactagt
tctactgtctttttgggagaaccaagtcgtcagcaattgaaaggaaatgttgcatcgaaa
gctccacgttctcaagctaatccatttttctcttctcctgtcagatctcttgagctattc
aaatctggaagtcgtaattgcttacatttagagttggatatcgcagactctggtatgcga
tatcaaacaggtgattacgcttctatttgtcctatgaatcctagtcaagctgttgatgat
cttctcgaagttctcggtctcaaagagaagagggatactgtaataattgttaaacctatc
gatactctcgataaggctcctgttttaagtcctactacctatgacactgtttttcgctac
tactatgaaatatgtggtatcgtctccaggcaactgctttcttttattgctcctttcgct
cctacaccagaatctaagcaagaactcgagaaattaggcaacgattatgactactttaag
aagaacgttgtagacttgcacctaaaccttgctcaagtccttcgtcgtgtttctcctgac
gctccatttacaaaacttccattctcaatgctattggaaaatatggcacacatgaaaccg
cgttactattcgatttcctcgagcagtgtagtgcatcctgacaaagttcacgttacagcg
gtagttgacaagaaagaatggactgataagaatcatatcttttatggactaactactaat
tatttgttggcacattgtcgtcatatgcacggtgaaaaaattccacatccaaatggtttg
gaatatacccttgagggtcctcgtaaaaactggaccggaaaaattccgatgtttgtaaag
aaatctacttttcgattggctcctcccgatgtccccataataatggtaggcccgggtact
ggtgtagccccattccgcggttttgtgatggaacgggctaatttagcttctaaaggagtt
aaagtagcaaaaacacttttattttatggttgccaatattctgacaaggattttttatat
aaggaagaatggcaacaatacaaagatgtcttgaaagactcttttgaactgattaccgca
ttttcccgtgagcaagatcataaaatctatgttcagcaccgtcttttagagcacagtgat
accattgctaaacttgtagaagaaggggctgctttttatatctgcggtgatgctgatcat
atggctaaagatgttgtgaatgcattggcttctattctgaccactgttgatgttgacggt
atgaaagccgttaaagctcttcgagatgacaatagattttttgaagatacctggtaa

DBGET integrated database retrieval system