KEGG   Schizosaccharomyces pombe (fission yeast): SPBC2D10.09Help
Entry
SPBC2D10.09       CDS       T00076                                 

Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase (predicted)
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00280  Valine, leucine and isoleucine degradation
spo00410  beta-Alanine metabolism
spo00640  Propanoate metabolism
spo01100  Metabolic pathways
spo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SPBC2D10.09
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPBC2D10.09
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPBC2D10.09
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     SPBC2D10.09
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1 DUF2095
Motif
Other DBs
NCBI-GeneID: 2540394
NCBI-ProteinID: NP_596228
PomBase: SPBC2D10.09
UniProt: O74802
Position
II:2981062..2982351
Genome map
AA seq 429 aa AA seqDB search
MGLKLNISNDLKKSGFMLRQSLLKTSVSNFLSLNASSTMSRAFIRNPKFYSTSSNDTVLY
ESKNGARIFTLNRPKVLNAINVDMIDSILPKLVSLEESNLAKVIILKGNGRSFSSGGDIK
AAALSIQDGKLPEVRHAFAQEYRLSHTLATYQKPVVALMNGITMGGGSGLAMHVPFRIAC
EDTMFAMPETGIGYFTDVAASFFFSRLPGYFGTYLGLTSQIVKGYDCLRTGIATHFVPKH
MFPHLEDRLAELNTSDISKINNTILEFAEFASSSPPTFTPDVMDVINKCFCKNDTVDIIR
ALKEYASNTSALAEFAKSTVKTLYSKSPTSIAVTNRLIKSAAKWSISEAFYYDHIVSYYM
LKQPDFVEGVNAQLITKTKNPKWSKSHEYHFKDLENYFKLPSEYNNGISFAAKGRRKTPL
WNYKTYPYL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgggattgaaattaaatatctctaacgatttgaaaaaatctggatttatgttaaggcaa
tccttacttaaaacaagtgtgtcaaatttcctttctttgaatgcaagtagcaccatgtct
agagcgtttattcgaaatccaaaattttatagcacttcctcaaatgatacagttttatac
gagagtaaaaatggagcaaggatatttactttaaacaggccaaaagtattgaacgctatc
aacgttgacatgatagattcaatcctaccaaagctagtttcattagaagaatcaaatctg
gccaaggtaattattcttaaaggaaatggtcgctcttttagttcgggaggtgacattaaa
gctgcagcactttcaatacaagatggaaaattacctgaagttcgccatgcatttgctcaa
gagtatcgattaagccatacgttagctacataccagaaaccagttgtggctttgatgaat
ggcatcaccatgggaggtggatctggtttggctatgcatgttcctttccgtattgcgtgt
gaagatacgatgtttgctatgccagaaaccggaattggctattttactgacgtggctgcc
agtttcttcttcagtagactaccaggatactttggaacttatctgggattgacatctcaa
atcgtaaaaggatatgattgcctgcgtactggaattgcaactcatttcgttccgaagcat
atgtttcctcatttggaggacaggcttgcagagttaaacacgtctgatatttctaaaatc
aataatacaatcctggaatttgccgaatttgctagcagttcaccacccacttttactcca
gacgttatggatgtcattaataaatgcttctgcaaaaatgataccgttgatattattcgt
gcgttaaaagaatatgcttcaaacactagtgctttagcggaatttgcaaaatctaccgtt
aaaacattgtatagcaaatctccgacttcaattgctgttaccaatcgacttattaagtct
gctgctaagtggagtatatctgaagcattttactatgatcatatcgtttcctattatatg
cttaaacagcctgattttgttgaaggtgttaatgctcaacttattacaaagaccaaaaat
ccaaaatggagcaaatcccatgaatatcactttaaagatttagaaaactatttcaagttg
ccttcagaatacaataatgggatatcttttgctgcaaaaggaagacgtaaaactcccctt
tggaattataagacttatccttatttataa

DBGET integrated database retrieval system