KEGG   Schizosaccharomyces pombe (fission yeast): SPBC2D10.09Help
Entry
SPBC2D10.09       CDS       T00076                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase (predicted)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPBC2D10.09
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SPBC2D10.09
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPBC2D10.09
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPBC2D10.09
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     SPBC2D10.09
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:2981062..2982351
Genome map
AA seq 429 aa AA seqDB search
MGLKLNISNDLKKSGFMLRQSLLKTSVSNFLSLNASSTMSRAFIRNPKFYSTSSNDTVLY
ESKNGARIFTLNRPKVLNAINVDMIDSILPKLVSLEESNLAKVIILKGNGRSFSSGGDIK
AAALSIQDGKLPEVRHAFAQEYRLSHTLATYQKPVVALMNGITMGGGSGLAMHVPFRIAC
EDTMFAMPETGIGYFTDVAASFFFSRLPGYFGTYLGLTSQIVKGYDCLRTGIATHFVPKH
MFPHLEDRLAELNTSDISKINNTILEFAEFASSSPPTFTPDVMDVINKCFCKNDTVDIIR
ALKEYASNTSALAEFAKSTVKTLYSKSPTSIAVTNRLIKSAAKWSISEAFYYDHIVSYYM
LKQPDFVEGVNAQLITKTKNPKWSKSHEYHFKDLENYFKLPSEYNNGISFAAKGRRKTPL
WNYKTYPYL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgggattgaaattaaatatctctaacgatttgaaaaaatctggatttatgttaaggcaa
tccttacttaaaacaagtgtgtcaaatttcctttctttgaatgcaagtagcaccatgtct
agagcgtttattcgaaatccaaaattttatagcacttcctcaaatgatacagttttatac
gagagtaaaaatggagcaaggatatttactttaaacaggccaaaagtattgaacgctatc
aacgttgacatgatagattcaatcctaccaaagctagtttcattagaagaatcaaatctg
gccaaggtaattattcttaaaggaaatggtcgctcttttagttcgggaggtgacattaaa
gctgcagcactttcaatacaagatggaaaattacctgaagttcgccatgcatttgctcaa
gagtatcgattaagccatacgttagctacataccagaaaccagttgtggctttgatgaat
ggcatcaccatgggaggtggatctggtttggctatgcatgttcctttccgtattgcgtgt
gaagatacgatgtttgctatgccagaaaccggaattggctattttactgacgtggctgcc
agtttcttcttcagtagactaccaggatactttggaacttatctgggattgacatctcaa
atcgtaaaaggatatgattgcctgcgtactggaattgcaactcatttcgttccgaagcat
atgtttcctcatttggaggacaggcttgcagagttaaacacgtctgatatttctaaaatc
aataatacaatcctggaatttgccgaatttgctagcagttcaccacccacttttactcca
gacgttatggatgtcattaataaatgcttctgcaaaaatgataccgttgatattattcgt
gcgttaaaagaatatgcttcaaacactagtgctttagcggaatttgcaaaatctaccgtt
aaaacattgtatagcaaatctccgacttcaattgctgttaccaatcgacttattaagtct
gctgctaagtggagtatatctgaagcattttactatgatcatatcgtttcctattatatg
cttaaacagcctgattttgttgaaggtgttaatgctcaacttattacaaagaccaaaaat
ccaaaatggagcaaatcccatgaatatcactttaaagatttagaaaactatttcaagttg
ccttcagaatacaataatgggatatcttttgctgcaaaaggaagacgtaaaactcccctt
tggaattataagacttatccttatttataa

DBGET integrated database retrieval system