KEGG   Schizosaccharomyces pombe (fission yeast): SPBC2D10.20Help
Entry
SPBC2D10.20       CDS       T00076                                 

Gene name
ubc1
Definition
ubiquitin conjugating enzyme Ubc1 (predicted) (EC:6.3.2.19)
Orthology
K04649  
ubiquitin-conjugating enzyme (huntingtin interacting protein 2) [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPBC2D10.20 (ubc1)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     SPBC2D10.20 (ubc1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(3004435..3004477,3004524..3004580,3004625..3004672,3004783..3004814,3004878..3004881,3004921..3005390)
Genome map
AA seq 217 aa AA seqDB search
MSDNRSRRIAKELADVQQDKQAGIQVWTINDDISHLKGMFRGPEGTPYEGGYFVVDIEIP
IDYPFRPPKMNFDTKIYHPNVSSQTGAICLDILKDQWSPVYTMKSALISLQSLLCTPEPS
NPQDAQVAQVYLQNYQQFVRTAREWTSSYAAAPAGVDLDAENTEFGGIDPNIITNLQQFG
FSTELIVRVLQREHIKSQEDLKDYPNGINGILDQLLH
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaatcgttctcgtagaattgctaaagaacttgctgatgttcaacaggataag
caagcaggaattcaagtatggactataaacgatgatatatcacatttaaaaggaatgttt
agaggtcctgagggaactccttatgagggtggctacttcgtcgtcgatattgaaattcct
attgattatccatttcgcccccctaaaatgaattttgatactaaaatttatcatcctaac
gtttcttcccaaactggagctatttgtttagatatattaaaggatcaatggtcaccggtt
tatacaatgaaatcagctttaataagtttacaatcacttttgtgcactccagagccgtca
aatcctcaagatgctcaggtagctcaagtgtatctgcaaaactaccaacaatttgtccga
accgcccgcgaatggacaagttcttatgctgccgcacctgcaggagttgacttagatgca
gaaaatacagagtttggtggaattgatccaaacattattacaaatctacagcaatttgga
ttttcaacagagcttatagtacgggttttacaaagggaacacataaagagccaagaagat
cttaaggactatccaaacggcatcaatgggattttagatcagctattacattaa

DBGET integrated database retrieval system