KEGG   Schizosaccharomyces pombe (fission yeast): SPBC30D10.10cHelp
Entry
SPBC30D10.10c     CDS       T00076                                 

Gene name
tor1
Definition
phosphatidylinositol kinase Tor1 (EC:2.7.1.137)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:3075961..3082968
Genome map
AA seq 2335 aa AA seqDB search
MEYFSDLKNKNESIQLAAADQLKEFVHSSTKELSGESLARFNNDINRRIFELIHSHDSHE
RFGGILAIGKLIEFESEGDVTNLSRYANYLRMTLPSTDWHSMELSAKVLGHLAASGGTLA
AEFVEFEVQRAFEWLQGDRQEQKRMAAILIIKALAQNSPTLVYLYISEIFQNLWTGLRDP
KPLIRETAADALGASLDVVCQREAKVQLQCFNEVLLQAEHGLRQSSVEYLHGSLLAYKEL
FEKSGSFIREHYTEFCDLALRLREHRDNSIRRCIVFLLPTLSEYNPKKFQQRYLDSFMVY
LLSHIRKDKEKSLAFEAIGRIAMAVNEAMIPYLQNILKVIRDTLTAKVREKTQYEKPVFE
CIGMLAAAVKLELLEDSRSLLGLIFSCELSVHLRQALVKMAENIPPLLAPIQERLLNMVS
QILTGKNFEIRTNDTYTPSFTNIYSAREPDQRSKSTESIILALETLGTFNFTGYSLISFI
QESVLSYLENDNSEIRIAAARTCCQVFARDPICRKTNPLAVESVAEVLEKLLTLGIADSD
PKIRETVLSLLDERFDRHLAHPDNIRCLFIALNDEVFSIREIAIIIIGRLALYNPAHVMP
SLRKTIIQLLSDMEYSGNSRQKEESAQLLKLLVSKARTLIKPYIQSIIHVILPKAADTSP
GVSSAIISALGELASVEGEDMPVDVRGSFMKLILVNLQDQSSTLKRLASLKCLRKLCGRS
GYVIQPYLDYPPLLGALIGILQSEQPTPIRREVLRTLGVLGALDPYTYLTTEEVSDDLQS
SHNNAHGVPQISAAQYPSLENYAMVAVVTLIGILKDSSLSMHHSSVVQAVMHICSQMGSK
STVFLPQVVPTFLQVMQSLSASSAEFYFQQLTTLTSIIGPNIRDYVSDIFNLSKVFWEST
TSLLLVILELIDAIAIALQDEFKFYLPQILSCMLKAFSLDNTSSRSVSYKVLQSFVIFGS
NIEEYMHLVLPVIIRSFERDTIPLGFRKSALKCIAQLFQSVNFSDHASRIIHPLVRMLGK
SNGDLRAVIMDTLCAIVSQLGYDYSIFIPMVNKVLVSHKISHPAYELLVSRLLKGEPLPK
DVVVKEFKPRPSTKPFSTQDEVLTKLPVDQASLKAAWESSQKLTRDDWQDWIRRISIELL
KESPSSALRSCSTLAGIYHPLARDLFNVSFLSCWDELTESNKKNLVKSIELAMNAPNISV
EILQTLLNLAEYMEREDHTLPIPIKVISAHASKCNVYAKALHYTELQFVQETKEEVSIST
IESLITINNHLQQSDAAVGMLQYTKEHKQFSLKETWYEKLHRWDDALAAYEHREREGDSS
FEINIGKLRCYYALGDWDHLSELAQKAWVTSEQEHREAIAPLAAAAAWGLGQWNLISEYV
SAMDRDPQDKEFFSAISAVHLGQYNKAYGHIERHRDILVNDLSSIIGESYNRAYGIMVKS
QMLSELEEIIDYKKNMQYENNLDSLKKTWRKRLEGCQKNVDVWHNTLRFRALVLSPQDSP
EMWIKLADLCRRSDRLKLSNQCLTYLMGRDPSNAYPLDSLKLLNPHVVYTYLKYLWATDQ
KNIAVSELEEFTSYLSSKHGYKMGDSSKLVDILASSSVSSEERSFLARCFHKLGKWKKSL
QDSVNQESVRDILNCYFYATLFDKSWYKAWHSWALANFEVVGYYEQTEHGVTQDMYEQYI
VPAIKGFFHSSVLNQKNSLQDILRLLNLWFKFGEHSDVAAAIVEGFSNVPMDTWLEVIPQ
LIARIHTSSSSVRASVHQLLSDIGRVHPQALVYSLTVSSKSTNPQQKHSAKSIMDSMLSH
SDTLVRQALLVSQELIRVAILWHELWYEGLEEASQAYFSDHDISLMIDIVKPLHETLEKG
PSTLSEISFAQTFGYDLRKARSYWQKFLQDGDPTELNQSWDLYYQVFRRIQKQLPRIKHL
ELQYVSPKLLDACDLELAVPGTYGHNKPVIRISHFHHTFEVISSKQRPRRLTIHGSDGKD
YQYVLKGHEDLRQDERVMQLFGLCNTLLTTDSETFKRRLNIERYTVIPLSPNSGLLGWVP
HSDTLHFLIKEFRSKRNILLNLEHRMMLQMAPDCDSLTLLQKLEVFEYVMANTDGYDLYH
VLWLKSRSSEAWLDRRTSYTQSLAVMSMVGYILGLGDRHPSNLMMDRYSGKIIHIDFGDC
FEVAMHREKFPEKIPFRLTRMLINAMEVSGIQGTYKITCELVMRVLRSNTESLMAVLEAF
VYDPLINWRLMTKSSFGASTTLRPTSSSVEEKGRSYTHRARHADYAALSETNGVNAEGLN
ERSIQVLKRVSNKLTGKDFDLKEQLPVKAQVEKLIQQATAPENLCRCYVGWCSFW
NT seq 7008 nt NT seq  +upstreamnt  +downstreamnt
atggagtattttagtgatctaaaaaacaaaaatgaaagcattcaactagcagccgctgat
caattaaaagaatttgtacatagttctactaaggaattatcaggtgaatcccttgcgcgt
ttcaataacgatatcaatcgtcgaatttttgagcttattcatagccatgattcccacgaa
agatttggaggaatccttgcgataggcaagctaattgaattcgaaagtgagggagatgtt
actaatctttcgcggtatgcaaattacttacgaatgacccttcctagtacggattggcat
tcgatggaactatctgcgaaggttcttggtcatttggctgcgtctggtggtacccttgca
gccgaattcgttgaatttgaagttcagcgtgctttcgagtggcttcaaggagaccgtcaa
gagcaaaaacggatggcggctattttaattattaaggctttagcacaaaattctcctacc
ttagtttacttgtatattagtgaaattttccaaaatttgtggactggattgcgtgatcca
aagcctcttattcgggaaactgctgctgatgctttgggtgcttctttagacgtggtttgt
caaagagaagctaaagttcaattgcagtgttttaatgaagttctgcttcaagctgaacat
ggtttacgacagtcgagtgtggaatatctgcatggaagtcttctcgcatacaaagagctt
ttcgaaaaatctggctcttttattcgtgaacattacacagaattttgtgatttggcgctt
cgtttacgagagcatagagataactctatcagacgctgcatagtatttttactgcctaca
ttgtctgaatataaccccaaaaaatttcaacagcgttatttagattcttttatggtttac
ttactttcccatatcaggaaagacaaggaaaagtctttagcttttgaagctattggaaga
atagccatggcagtcaatgaagcaatgattccttatttacagaatattttaaaagtaata
agggatacattgacagcaaaagtacgtgaaaaaacgcaatatgaaaagcctgtttttgaa
tgcattggcatgttggctgctgctgtaaagcttgaactccttgaagattctcgaagtcta
cttggtctgattttttcttgcgaactgagcgttcacttgcgtcaagctcttgtgaaaatg
gcagaaaacatccctcctcttttggctcctattcaagaacgattattgaatatggttagt
caaattttgactggaaaaaactttgaaattcgtactaatgacacatatactcccagtttc
actaatatatactctgctagggaacctgaccaaagaagtaaaagcacggaatcaattatt
ttggctttagaaactttgggtacttttaattttactggttattcattaattagtttcatc
caagaatctgtcttatcttacttggaaaatgataattcagagatccgtattgctgctgca
cgaacttgctgtcaggtttttgccagagatccgatatgtagaaaaacaaatcctttggct
gttgaatcagtcgctgaggtgcttgaaaagctattaacccttggaattgcagatagtgat
ccaaaaattagggaaaccgtactctcattactagatgaaagatttgatcggcatttggca
catcctgataatattcgttgcttatttatcgctctgaatgatgaagttttttcaatcaga
gaaattgctatcattattataggaaggcttgcattgtataatccggcccatgtgatgcca
tcgctacgaaaaactattattcagttattatctgacatggaatattcgggtaatagtcgt
caaaaagaagaaagcgcacagcttctcaaattactggtatccaaagctagaacactcatt
aagccatatatccaatcgatcattcatgtaatattaccgaaagcagcagatacgagtcct
ggagtttcatctgccattatatcagctttaggtgaactcgcaagtgttgaaggagaagat
atgcctgtggatgttcgtggttccttcatgaagttaatacttgtgaatttacaggatcaa
agctctacattgaagcgacttgcttctcttaaatgtttacgaaaactttgtggtcgttca
ggttatgtaattcagccatatttagattaccctcctttgttgggcgcgctaattggtatt
ttgcaatcagaacaaccaacaccgataagaagagaagtactgagaacattaggtgtgtta
ggtgctttagatccatatacgtatttaactactgaggaagtttcagatgatttacaaagt
agtcataataatgcccatggtgtacctcaaattagtgccgcgcagtacccgtcattggaa
aactacgctatggttgctgttgtcactttgataggtattttaaaagacagttcgctctct
atgcatcactcttctgttgttcaagcagtgatgcatatttgctctcaaatgggatctaaa
tctactgtatttttacctcaagtggtaccaacgtttctacaagtaatgcaatccttatcg
gcttcctcggctgagttttattttcagcagttaacgactttaacttctattattggacca
aacattagggattatgtatctgatatttttaatctttcaaaagtcttttgggaatctacc
acatctctattgctagttattcttgaactcatcgatgccatagcaattgcactgcaggat
gaatttaaattttacttgcctcaaatattatcttgtatgttgaaagcattttcccttgat
aatacgtcttcccgttccgtttcatacaaagttttacaatcatttgttatatttggttct
aatattgaagaatacatgcatcttgttctaccagttataattagaagttttgagcgtgat
actataccccttggattcaggaagagtgccctcaaatgcattgcccaattatttcaatct
gttaatttctcggatcatgcctctcgaatcattcatccattggttcgcatgctagggaaa
tctaatggcgatttgagagcagttattatggatactctttgtgctatagtatcgcaactt
gggtatgattattcgatttttataccgatggtgaataaagttttggttagtcacaagata
agtcatccggcttacgaacttttggtttcacgacttttgaaaggtgagcctctacccaaa
gatgtcgtagtaaaggagtttaagccgaggccctcaacaaagcctttttctacacaagat
gaagtcttgacaaagcttcctgttgatcaagcatccttgaaagcagcatgggaatcatca
caaaaattgacaagggatgattggcaggactggataagaagaataagtattgaacttctg
aaggaatccccttcttcggcacttaggtcttgttcgaccttagctggtatataccatcca
ttggctcgcgatttatttaatgtcagttttttgtcttgttgggatgagttaactgaaagc
aataagaaaaatctcgttaaatcaatagagctcgctatgaatgcccctaacatttcagta
gaaatattacagactctgttaaatcttgctgagtatatggagcgtgaagatcatacatta
ccaattcctatcaaagtaattagtgctcatgcatctaagtgtaatgtttatgccaaggct
ctgcattatacagaattacaattcgttcaagagacgaaagaggaagttagcattagcact
atcgagtctctcattaccataaacaatcatctgcaacaatccgatgccgctgtaggtatg
cttcaatataccaaagaacacaagcagtttagtttgaaagaaacttggtatgaaaaatta
catagatgggatgatgcattagctgcatatgagcatcgagaacgtgaaggtgactcgtct
ttcgagataaatatcggaaaattacgctgttattatgctttgggtgactgggatcacctt
tccgaattggcacaaaaagcttgggtaacgtctgaacaagaacatcgtgaagctattgct
ccacttgcagctgccgctgcttggggtttgggtcaatggaatttaattagtgaatatgtt
agtgccatggaccgtgacccacaagataaagagtttttttccgctattagtgctgtacat
cttggtcaatacaataaggcgtatggccatatcgagagacatcgtgatatattagtaaac
gacctttcttccataatcggtgaaagctataatcgtgcatatggtattatggtcaaatcc
caaatgctttcggaacttgaagaaattattgactataaaaagaatatgcaatatgaaaac
aatttggactctcttaaaaaaacgtggcggaaaaggcttgaaggatgtcagaaaaatgtg
gatgtttggcataatacgcttcggtttagggctctggtattgtctccacaagattctcct
gaaatgtggataaaattagctgatctttgccgtcgttctgaccggttgaagctttcaaat
cagtgtctcacatatttgatgggtcgcgatccttcaaatgcttacccgcttgactcactt
aagcttctcaatcctcatgttgtatatacgtatttaaaatatttgtgggctacagatcaa
aaaaatattgcggtatcggagctcgaagagttcacctcatatctatcgtcaaaacatggg
tataaaatgggtgattcttcaaagttggttgatattttagcctcatcatctgtaagttcg
gaagagcgttcgtttttagcaaggtgttttcataaacttggcaaatggaaaaagtctctt
caagatagtgttaatcaagaaagcgtaagggatattttgaattgttatttttatgctact
ttgttcgataaatcgtggtataaagcttggcactcttgggctctcgcaaatttcgaagtc
gttggttattatgaacagactgaacatggggttacccaagatatgtatgaacaatatatt
gtacctgctattaaaggattttttcactcttctgttttaaatcaaaaaaactcacttcag
gatatattgcggttacttaatttatggtttaaattcggtgagcacagcgacgtagcagcc
gcaattgttgaaggattttccaatgttccaatggatacatggttagaagttataccacaa
ctaattgcacgaatacacacttcaagttcttcagttagagcatctgttcatcagttactt
tccgatattggtagggtgcatcctcaggcattggtgtattcacttactgtgtcctccaaa
tctacaaatccgcagcagaagcattcagcaaaatcaattatggatagcatgctttcgcat
agtgatacgttggttcgtcaagctctacttgttagtcaagagctaattagagttgctata
ctttggcatgaattatggtatgaaggattagaggaagcttctcaagcttatttttcagat
cacgatatatctttaatgattgatattgtgaaacccctgcatgaaacattggagaagggt
ccttccaccttgtctgagatatcatttgctcagacatttgggtatgatttacgtaaagct
agaagttactggcagaaatttttgcaagatggtgaccctacggaattaaatcagtcttgg
gatttgtattatcaagtctttagacgtattcaaaagcaattaccacggattaagcatttg
gagctacaatatgtttcccctaagttattggatgcttgtgatttggaactagctgtgcct
ggaacctatggtcataacaaaccggtcattcggatctcgcatttccatcacactttcgaa
gttatttcttctaagcaaaggccaagaagattgacaattcatggtagtgatggcaaagat
tatcagtatgtccttaagggtcatgaagatttgaggcaagatgaacgagttatgcagctt
tttggtttatgtaatacgttactgactacggattctgagacattcaaacgacgtctgaat
atagagcgttatacagttattccgctatctcccaattctggtttgctggggtgggttccg
catagtgatacattacatttcctgatcaaagagtttcgctcaaagcgtaacatattgtta
aatttagagcatcgcatgatgcttcaaatggcacccgactgcgacagtttaacattattg
caaaaactagaagtattcgaatatgttatggctaatactgatggttatgatttgtatcat
gtgttgtggcttaaaagtcgaagttcagaagcatggcttgataggagaaccagctatact
caaagcttggcagtcatgtcaatggttggatatatacttggacttggtgaccgacatcct
tccaatctaatgatggatcggtattctggtaagatcattcatattgactttggtgattgt
tttgaggttgccatgcatagagaaaaatttcctgagaaaataccgtttcgacttactcga
atgcttattaatgctatggaggttagcggtatccaaggtacttacaaaattacttgcgag
cttgttatgcgtgttttaagatcaaatacggagtctttaatggcagttcttgaagcattt
gtctatgaccctttgattaattggagacttatgactaaaagctctttcggggcttctacg
acactccggcctacctcaagtagtgtagaagagaaaggaaggtcctacactcatcgtgcg
cgtcacgctgattatgcagctcttagtgaaacaaatggtgtaaacgccgaaggactcaac
gagagatctattcaagtcttgaagcgtgtctcaaataagctaactggtaaagatttcgat
ttgaaagagcaattgccagtcaaagcgcaagttgaaaagcttatccaacaagctacagct
cccgaaaatctttgccgttgttatgtaggatggtgtagtttttggtaa

DBGET integrated database retrieval system