KEGG   Schizosaccharomyces pombe (fission yeast): SPBC32F12.03cHelp
Entry
SPBC32F12.03c     CDS       T00076                                 

Gene name
gpx1
Definition
glutathione peroxidase Gpx1 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SPBC32F12.03c (gpx1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SPBC32F12.03c (gpx1)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SPBC32F12.03c (gpx1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(2789071..2789547)
Genome map
AA seq 158 aa AA seqDB search
MSHFYDLAPKDKDGNPFPFSNLKGKVVLVVNTASKCGFTPQYKGLEALYQKYKDRGFIIL
GFPCNQFGNQEPGSDEEIAQFCQKNYGVTFPVLAKINVNGDNVDPVYQFLKSQKKQLGLE
RIKWNFEKFLVNRQGQVIERYSSISKPEHLENDIESVL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatttctacgacttggctcctaaggacaaggatggaaatccttttcctttcagc
aacttgaagggtaaagtggtccttgttgtcaatacagcgagcaaatgtggattcactcct
caatacaaaggtcttgaggcgttgtatcagaaatacaaggatagaggatttatcatcctt
ggattcccttgcaatcaatttggaaaccaagaacccggttctgacgaagaaatcgctcaa
ttttgccaaaagaactatggcgtaaccttccctgtactggccaagatcaatgttaatggc
gacaacgtcgaccctgtttatcaattcttgaagagccaaaagaagcaacttggccttgag
cgtattaagtggaattttgaaaagttcttggtcaatcgtcaaggtcaagtcatcgaacgc
tattccagtattagcaagcctgaacatctcgaaaacgatatcgagagtgtcctttaa

DBGET integrated database retrieval system