KEGG   Schizosaccharomyces pombe (fission yeast): SPBC3D6.13cHelp
Entry
SPBC3D6.13c       CDS       T00076                                 

Gene name
pdi2
Definition
ER associated protein disulfide isomerase Pdi2 (predicted)
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPBC3D6.13c (pdi2)
Enzymes [BR:spo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SPBC3D6.13c (pdi2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(1293702..1295882)
Genome map
AA seq 726 aa AA seqDB search
MRSNTFGSVMRISWVVAFITMVQTLVSGVPLTDNDLESEVSKGTWFIKYYLPSCGACKRL
GPMWDNMVEKAKEQVEGSNFHFGEVDCSKELSSCANIRAVPTLYLYQNGEIVEEVPFGAS
TSEASLLDFVETHLNPDTDPDIPSDEDVLTDEDTEEVASIQPALSTSVSSLSLASTAMSK
SASASEFSGSSVTKASKKLTSSPTSVASKKATLSSVSKVASTSSLPVTSVSASVDPKSAA
SKVQDAEFSIQTAPSFPKEKEEKENTEETEESKKSINPTGTSKALALDADIDAALTDKEG
WFIQFYSSECDDCDDVSTAWYAMANRMRGKLNVAHINCAVSKRACKQYSIQYFPTFLFFK
EEAFVEYVGLPNEGDLVSFAEEAANFEIREVELLDTVNAEKNGDVFFLYFYDDDSAEYLN
IIRKTGIQLLGHANLYLTTSQQIAKKYRVVSFPKLIVVRDGIASYYPAKMAQDNKDYRRI
LGWMKNNWLPVLPELRTSNSKEIFNDESVVLFLLNPELDDFDETKRTAQKIATEFLDEEG
RTYQSNWQKETDKKNSLVNEAEEKNDLEAIEAAKNFHVNGKPSPTRFAWVNGKFWAQWLR
KFDIDIEATGPRVIVYNAAQDIYWDETAKGTPISIEKDTVFDIIKQVETDPDHLKFKILK
KNLGVEYLESYGLNIRVLYMVLGIVTVGILVWYFSGRRARTLQRRRHSTPILPVSMRSTG
NSGKFD
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcaaacacctttggttctgtaatgcgtatttcgtgggttgtagcctttataacg
atggttcaaaccctcgtttcgggagttccacttactgacaatgatttggagtcggaagtc
tcgaagggaacttggtttataaagtattatttgccaagctgtggtgcctgtaaaagattg
ggcccaatgtgggataacatggttgagaaggcaaaagaacaagttgaaggctctaacttt
cactttggtgaagttgattgctccaaagagctttcttcttgcgcgaatattcgtgctgtt
cccactctctatctatatcagaatggtgaaatcgtcgaagaagttccttttggcgcttcc
accagcgaggcttctttattagactttgtagagacccatttgaaccctgatactgatcct
gatatcccatccgatgaggatgtgttgacagacgaagatacagaagaagtcgcctctatc
caacccgctctctccacttccgtctcttctctttcattagcttctactgccatgtccaaa
agtgcatctgcttctgaatttagtggctcgagcgttactaaggcttccaaaaagcttaca
tcttctcctacttctgtggcatcaaaaaaagccaccctcagcagcgtatctaaggttgct
tctacctcctctcttcctgtcacctccgtatccgcctccgtagatcccaaatccgcagct
tccaaggttcaggacgctgaattttcgatccagaccgctccaagctttcctaaggagaag
gaagaaaaggaaaacactgaagaaactgaggaatcgaaaaagtccatcaacccaacaggt
acttccaaagccctagcacttgatgctgatattgatgctgcgttgaccgataaggaaggt
tggtttatccaattttattcttccgaatgcgatgattgcgacgacgtctccactgcttgg
tatgccatggctaaccgtatgcgtggtaaacttaatgtcgcacatattaactgtgctgtt
tcaaaacgtgcttgcaagcaatacagtattcaatacttcccaacattccttttctttaag
gaagaagcttttgtggagtatgtcggacttcccaatgagggtgatttagttagctttgca
gaggaagctgcaaactttgagattcgcgaggtagaactactggatactgttaacgccgaa
aagaacggtgatgtctttttcttgtacttttacgatgacgatagtgccgaatatttgaat
atcattcgtaaaactggaatccagcttttaggacatgctaacttgtatcttactacctca
cagcaaattgccaagaaatatcgcgttgtttccttccccaagctcattgttgttcgtgat
ggcatagctagttattatccggctaaaatggcacaggacaacaaggactatagaagaata
cttggttggatgaaaaacaattggcttcctgttcttcctgaacttcgtacatccaattcc
aaagaaattttcaacgatgaaagtgtcgtgctgttcttgttaaatcctgagttagatgac
tttgatgaaactaagcgtactgctcaaaagattgctaccgaatttttagatgaagaaggc
cgtacttaccagtcaaactggcaaaaagaaactgacaaaaagaactctttagtaaacgag
gctgaagagaaaaatgacttagaggcaatagaagctgcaaagaattttcatgtaaatggc
aagccatctcctactagatttgcatgggtgaatggtaaattctgggctcagtggttgcgt
aagtttgacattgatattgaagcaactgggccacgtgtgattgtgtataatgctgctcaa
gatatttattgggatgaaaccgctaagggaactcctatttctattgaaaaggatactgta
tttgacattattaagcaggttgaaaccgatcccgaccatttgaaatttaaaattctaaag
aagaatcttggtgtcgaatatttggaatcatatggattgaatattcgtgttctgtatatg
gtcttggggattgttaccgttggaatattagtgtggtactttagcggaagaagagctaga
actcttcaacgtcgtagacattccaccccaatccttcctgtttctatgagaagcactgga
aacagtggaaagtttgattaa

DBGET integrated database retrieval system