KEGG   Schizosaccharomyces pombe (fission yeast): SPBC409.05Help
Entry
SPBC409.05        CDS       T00076                                 

Gene name
skp1, psh1, sph1
Definition
(RefSeq) SCF ubiquitin ligase complex subunit Skp1
  KO
K03094  
S-phase kinase-associated protein 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Module
SCF-MET30 complex
SCF-BTRC complex
SCF-CDC4 complex
SCF-GRR1 complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPBC409.05 (skp1)
   04120 Ubiquitin mediated proteolysis
    SPBC409.05 (skp1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPBC409.05 (skp1)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     SPBC409.05 (skp1)
   Cul7 complex
     SPBC409.05 (skp1)
Chromosome [BR:spo03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     SPBC409.05 (skp1)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     SPBC409.05 (skp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(1140148..1140196,1140250..1140297,1140372..1140739,1140785..1140805)
Genome map
AA seq 161 aa AA seqDB search
MSKIKLISSDNEEFVVDQLIAERSMLIKNMLEDVGEINVPIPLPNVSSNVLRKVLEWCEH
HKNDLYSGTEEESDIRLKKSTDIDEWDRKFMAVDQEMLFEIVLASNYLDIKPLLDTGCKT
VANMIRGKSPEDIRKTFNIPNDFTPEEEEQIRKENEWAEDR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatcaaactgatttcatctgacaatgaagagttcgtggtcgatcaactgatc
gctgagagaagtatgcttataaaaaatatgcttgaagacgttggtgagattaatgtcccc
attcctcttccaaacgtatcatcgaacgttttgcgaaaggtactcgaatggtgtgagcat
cacaaaaacgatttgtattcaggaactgaggaggaaagtgacattagattaaaaaagtct
accgatattgatgaatgggatcgtaagtttatggccgtagaccaggaaatgttgttcgag
atagttttggcaagcaattatttggatattaaacctttgcttgatactggttgtaaaacc
gttgccaacatgattcgtggcaagagtcctgaggacattcggaaaacatttaacatccct
aatgattttacgcctgaggaggaagagcaaatccgtaaagaaaatgaatgggccgaagac
agatag

DBGET integrated database retrieval system