KEGG   Schizosaccharomyces pombe (fission yeast): SPBC409.05Help
Entry
SPBC409.05        CDS       T00076                                 

Gene name
skp1, psh1, sph1
Definition
SCF ubiquitin ligase complex subunit Skp1
Orthology
K03094  
S-phase kinase-associated protein 1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Module
SCF-MET30 complex
SCF-BTRC complex
SCF-CDC4 complex
SCF-GRR1 complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPBC409.05 (skp1)
   04120 Ubiquitin mediated proteolysis
    SPBC409.05 (skp1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPBC409.05 (skp1)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    adaptor protein
     SPBC409.05 (skp1)
   Cul7 complex
     SPBC409.05 (skp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(1140148..1140196,1140250..1140297,1140372..1140739,1140785..1140805)
Genome map
AA seq 161 aa AA seqDB search
MSKIKLISSDNEEFVVDQLIAERSMLIKNMLEDVGEINVPIPLPNVSSNVLRKVLEWCEH
HKNDLYSGTEEESDIRLKKSTDIDEWDRKFMAVDQEMLFEIVLASNYLDIKPLLDTGCKT
VANMIRGKSPEDIRKTFNIPNDFTPEEEEQIRKENEWAEDR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatcaaactgatttcatctgacaatgaagagttcgtggtcgatcaactgatc
gctgagagaagtatgcttataaaaaatatgcttgaagacgttggtgagattaatgtcccc
attcctcttccaaacgtatcatcgaacgttttgcgaaaggtactcgaatggtgtgagcat
cacaaaaacgatttgtattcaggaactgaggaggaaagtgacattagattaaaaaagtct
accgatattgatgaatgggatcgtaagtttatggccgtagaccaggaaatgttgttcgag
atagttttggcaagcaattatttggatattaaacctttgcttgatactggttgtaaaacc
gttgccaacatgattcgtggcaagagtcctgaggacattcggaaaacatttaacatccct
aatgattttacgcctgaggaggaagagcaaatccgtaaagaaaatgaatgggccgaagac
agatag

DBGET integrated database retrieval system