KEGG   Schizosaccharomyces pombe (fission yeast): SPBC409.06Help
Entry
SPBC409.06        CDS       T00076                                 

Gene name
uch2
Definition
ubiquitin C-terminal hydrolase Uch2
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SPBC409.06 (uch2)
Peptidases [BR:spo01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   SPBC409.06 (uch2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(1142220..1142344,1142496..1143273)
Genome map
AA seq 300 aa AA seqDB search
MSWTTIESDAGVFTDLIENLGVKDVEVDELYSLDVDSLRQFPDIYGIIFLFKWNSKVDKP
DGTMDYDSMDNIFFAKQVINNACATQALLSVLLNHSDEIDLGTTLSEFKDFSKTLPPELK
GEALGNSEHIRCCHNSFARSDPFISEEVRAATDEDEVYHFIAYTNINNVFYELDGLQAAP
INHGSCTKEEFAEKAVSVIQARIANYDPAEIRFNLMVICKDKKASLLTREDLTDEEKAAS
IAVEDEKRLRWKRENQLRRHNFVGLFVELSKLLVKDRIDKNTWNSTLETAKAKYASQKRP
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagttggactacaatagaatcagatgctggtgtatttacggatttaatagaaaatctg
ggtgttaaagatgtcgaagtagatgaactatacagtttagacgttgattcacttcgacag
tttccagatatttatggcatcatatttttgtttaaatggaacagtaaggttgacaagcct
gatggaacgatggactatgatagtatggacaatatattttttgctaagcaagtaatcaac
aatgcctgtgctacgcaagctctcttatcggtgctgctgaaccactcagacgaaattgat
ttgggaacgacactaagcgaattcaaagatttttcaaaaactttacctcctgaattaaag
ggcgaagcattgggaaattctgagcatattcgttgttgccataattcattcgcacggtct
gatcctttcattagtgaagaggttagggctgcaactgacgaagatgaagtgtatcatttt
attgcatacactaatattaacaacgtcttttatgagttagatggcctacaagctgctccg
attaatcacggatcttgtacgaaggaagagtttgctgagaaagcagtctctgtaatccag
gctcgtatcgctaattatgaccctgctgaaattcggttcaatttaatggttatctgcaaa
gataaaaaggcatctctccttaccagggaagacttgacagacgaggagaaagctgcttcc
attgctgttgaagacgaaaaacgtttacgttggaagcgtgaaaatcagcttcgtcgtcac
aatttcgtcggtctcttcgtagaactttccaaacttctggtaaaagatcgcattgacaag
aatacttggaactctacccttgaaactgcaaaagcgaaatacgcatctcaaaagcgaccg
taa

DBGET integrated database retrieval system