KEGG   Schizosaccharomyces pombe (fission yeast): SPBC409.07cHelp
Entry
SPBC409.07c       CDS       T00076                                 

Gene name
wis1, smf2, spc2
Definition
MAP kinase kinase Wis1
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:spo04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(1143967..1145784)
Genome map
AA seq 605 aa AA seqDB search
MSSPNNQPLSCSLRQLSISPTAPPGDVGTPGSLLSLSSSSSSNTDSSGSSLGSLSLNSNS
SGSDNDSKVSSPSREIPSDPPLPRAVPTVRLGRSTSSRSRNSLNLDMKDPSEKPRRSLPT
AAGQNNIGSPPTPPGPFPGGLSTDIQEKLKAFHASRSKSMPEVVNKISSPTTPIVGMGQR
GSYPLPNSQLAGRLSNSPVKSPNMPESGLAKSLAAARNPLLNRPTSFNRQTRIRRAPPGK
LDLSNSNPTSPVSPSSMASRRGLNIPPTLKQAVSETPFSTFSDILDAKSGTLNFKNKAVL
NSEGVNFSSGSSFRINMSEIIKLEELGKGNYGVVYKALHQPTGVTMALKEIRLSLEEATF
NQIIMELDILHKAVSPYIVDFYGAFFVEGSVFICMEYMDAGSMDKLYAGGIKDEGVLART
AYAVVQGLKTLKEEHNIIHRDVKPTNVLVNSNGQVKLCDFGVSGNLVASISKTNIGCQSY
MAPERIRVGGPTNGVLTYTVQADVWSLGLTILEMALGAYPYPPESYTSIFAQLSAICDGD
PPSLPDSFSPEARDFVNKCLNKNPSLRPDYHELANHPWLLKYQNADVDMASWAKGALKEK
GEKRS
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctccaaataatcaacccttgtcttgctcattgagacagctgtctatttctcct
accgcacctcccggtgatgttggtactcccggctcgctcctttctctttcgtcttcaagt
tcttcaaacaccgattcttctggttcttccttgggttccttgtctttaaattctaacagt
agtggcagtgacaatgactcaaaggtttcttctcctagtcgtgaaataccttccgatccc
cctcttccccgtgccgtgcctacggtcagacttggcagatctacgtccagtcggagtcgt
aactctcttaaccttgacatgaaggatccttcggaaaaacctagacgttcacttcctaca
gcagctggtcagaacaatattggatctcctcctactccaccgggcccatttcctggagga
ctttcaactgatatacaggagaaattgaaggccttccatgcatctagatcaaaatcaatg
ccggaagtagtcaacaagatcagtagtccaactacccctattgtcggtatgggtcaacga
ggaagttatcctttgcctaactctcaacttgctggtcgattaagtaattcgcccgtaaag
tctccgaatatgccagagtccgggcttgcaaaatcacttgctgctgctaggaatccttta
ctcaaccgtccaacgtccttcaatcgacaaacgagaatccgtcgtgcaccacctggaaaa
ctcgatttatccaattccaatcccaccagccctgtcagtccgtctagcatggcttctcgc
cgtggcctaaacattcctcccacccttaaacaggctgtttcggaaacccctttttccaca
ttttcggatattttggatgcaaaatcaggcaccttaaattttaaaaacaaagccgtgtta
aattcagaaggtgttaacttttcatctggctcttcgtttcgtattaatatgtcagagatt
attaagcttgaagaacttggaaaaggtaactatggtgttgtgtataaagcattgcatcaa
ccgactggtgtcactatggccttgaaggaaattaggttgtccttagaagaagcaacattt
aatcaaattataatggaattggatattttacataaagcagttagtccttatatcgttgac
ttttatggtgccttttttgtggaaggttctgtttttatttgtatggaatatatggatgct
ggtagcatggacaaactgtatgctggtggtatcaaagacgaaggagttttagctagaact
gcttatgctgtagtgcaaggcctcaaaactttgaaagaggagcataatatcattcatcgt
gacgttaaacctactaatgttttggtaaattctaatggccaggttaagttatgtgacttt
ggcgtgagtgggaatcttgtggcttctatatccaaaacgaacattggatgtcaatcttac
atggctcctgaaagaattcgtgttggtggacctaccaatggcgtcttgacttacaccgta
caggctgatgtgtggtctctaggccttaccattttagaaatggctttaggagcttatccg
tatccacctgaatcatatacttcaatatttgcacaactatcggcgatttgcgatggcgat
ccaccttctctccccgattcattttctcccgaagctcgtgattttgtaaacaagtgtttg
aataaaaacccgtctttgcgtcccgattatcatgagttggctaaccatccatggttgtta
aaatatcaaaatgcagatgtggacatggcttcatgggcaaaaggcgctcttaaagagaaa
ggtgaaaaaagaagctaa

DBGET integrated database retrieval system