KEGG   Schizosaccharomyces pombe (fission yeast): SPBC428.08cHelp
Entry
SPBC428.08c       CDS       T00076                                 

Gene name
clr4
Definition
histone H3 methyltransferase Clr4
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:spo00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:complement(456575..458047)
Genome map
AA seq 490 aa AA seqDB search
MSPKQEEYEVERIVDEKLDRNGAVKLYRIRWLNYSSRSDTWEPPENLSGCSAVLAEWKRR
KRRLKGSNSDSDSPHHASNPHPNSRQKHQHQTSKSVPRSQRFSRELNVKKENKKVFSSQT
TKRQSRKQSTALTTNDTSIILDDSLHTNSKKLGKTRNEVKEESQKRELVSNSIKEATSPK
TSSILTKPRNPSKLDSYTHLSFYEKRELFRKKLREIEGPEVTLVNEVDDEPCPSLDFQFI
SQYRLTQGVIPPDPNFQSGCNCSSLGGCDLNNPSRCECLDDLDEPTHFAYDAQGRVRADT
GAVIYECNSFCSCSMECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGE
VITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYTVDAQNYGDVSRFFNHSCSPNIAIYS
AVRNHGFRTIYDLAFFAIKDIQPLEELTFDYAGAKDFSPVQSQKSQQNRISKLRRQCKCG
SANCRGWLFG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctaaacaagaggagtatgaagttgaaaggattgtggacgaaaaattggatcgt
aatggagctgtcaaactatatcgcattcgatggttgaactattcatctagaagtgatact
tgggagccccctgagaacctttctggatgttctgccgttttagcagaatggaaaaggcgg
aagaggagactaaagggaagtaactccgactcggattcaccgcaccatgcgagcaatcca
catccaaacagtagacaaaagcaccaacatcaaacttcaaagtcagtgcctcgttctcaa
agattttcgcgggaattgaatgtaaaaaaggaaaataaaaaggttttttcttctcaaact
accaagagacaatctcgaaaacaatccaccgctctgacgacgaatgatactagtatcatt
ttagacgatagtcttcatacaaattcaaagaagctggggaagacgagaaatgaagtgaag
gaggaatctcaaaaaagagaactagtttccaattctattaaagaagctacatcccccaaa
acatcttcaattctcacaaaaccgcgaaacccttccaaacttgactcttatacccatcta
agtttttacgaaaagagagagctatttcgtaagaaactgcgggaaattgaaggacccgaa
gtaacgcttgtcaatgaagttgacgatgaaccctgtccatctttagattttcaattcatt
agccagtaccgcttaacacaaggtgttatcccgcctgatccaaattttcaatctggatgc
aattgctcgtcccttggcggttgtgaccttaacaatccttctcgttgtgagtgtttagat
gatttggatgagccaactcattttgcctatgatgcacaggggcgggtccgtgcagatacg
ggtgccgttatatatgaatgcaactctttttgttcttgttcaatggagtgtcctaatcgc
gttgttcaacgtggtagaactcttccgcttgaaatatttaaaacaaaagaaaaaggatgg
ggtgtacgttcgcttcgatttgcccctgctggcacgtttatcacttgctatttaggagaa
gtcataacttcagcagaggccgccaagcgtgacaaaaattatgacgacgacggtattacc
tatttatttgatttagacatgtttgatgatgctagcgagtatacagtggatgctcagaac
tatggagatgtctctcgtttttttaaccactcctgttcacctaatatagctatttattct
gctgttcggaaccatggatttcgaaccatttatgatctcgctttttttgccatcaaagac
attcagcctctagaggagcttacatttgattacgctggtgcaaaagatttctcacctgtt
caatctcaaaaatctcagcaaaatagaatttcaaaacttcgccggcagtgcaaatgtggt
tccgctaattgtcgtggctggcttttcggttaa

DBGET integrated database retrieval system