KEGG   Schizosaccharomyces pombe (fission yeast): SPBC428.08cHelp
Entry
SPBC428.08c       CDS       T00076                                 

Gene name
clr4
Definition
(RefSeq) histone H3 methyltransferase Clr4
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    SPBC428.08c (clr4)
Enzymes [BR:spo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     SPBC428.08c (clr4)
Chromosome [BR:spo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     SPBC428.08c (clr4)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    SPBC428.08c (clr4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
II:complement(456575..458047)
Genome map
AA seq 490 aa AA seqDB search
MSPKQEEYEVERIVDEKLDRNGAVKLYRIRWLNYSSRSDTWEPPENLSGCSAVLAEWKRR
KRRLKGSNSDSDSPHHASNPHPNSRQKHQHQTSKSVPRSQRFSRELNVKKENKKVFSSQT
TKRQSRKQSTALTTNDTSIILDDSLHTNSKKLGKTRNEVKEESQKRELVSNSIKEATSPK
TSSILTKPRNPSKLDSYTHLSFYEKRELFRKKLREIEGPEVTLVNEVDDEPCPSLDFQFI
SQYRLTQGVIPPDPNFQSGCNCSSLGGCDLNNPSRCECLDDLDEPTHFAYDAQGRVRADT
GAVIYECNSFCSCSMECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGE
VITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYTVDAQNYGDVSRFFNHSCSPNIAIYS
AVRNHGFRTIYDLAFFAIKDIQPLEELTFDYAGAKDFSPVQSQKSQQNRISKLRRQCKCG
SANCRGWLFG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctaaacaagaggagtatgaagttgaaaggattgtggacgaaaaattggatcgt
aatggagctgtcaaactatatcgcattcgatggttgaactattcatctagaagtgatact
tgggagccccctgagaacctttctggatgttctgccgttttagcagaatggaaaaggcgg
aagaggagactaaagggaagtaactccgactcggattcaccgcaccatgcgagcaatcca
catccaaacagtagacaaaagcaccaacatcaaacttcaaagtcagtgcctcgttctcaa
agattttcgcgggaattgaatgtaaaaaaggaaaataaaaaggttttttcttctcaaact
accaagagacaatctcgaaaacaatccaccgctctgacgacgaatgatactagtatcatt
ttagacgatagtcttcatacaaattcaaagaagctggggaagacgagaaatgaagtgaag
gaggaatctcaaaaaagagaactagtttccaattctattaaagaagctacatcccccaaa
acatcttcaattctcacaaaaccgcgaaacccttccaaacttgactcttatacccatcta
agtttttacgaaaagagagagctatttcgtaagaaactgcgggaaattgaaggacccgaa
gtaacgcttgtcaatgaagttgacgatgaaccctgtccatctttagattttcaattcatt
agccagtaccgcttaacacaaggtgttatcccgcctgatccaaattttcaatctggatgc
aattgctcgtcccttggcggttgtgaccttaacaatccttctcgttgtgagtgtttagat
gatttggatgagccaactcattttgcctatgatgcacaggggcgggtccgtgcagatacg
ggtgccgttatatatgaatgcaactctttttgttcttgttcaatggagtgtcctaatcgc
gttgttcaacgtggtagaactcttccgcttgaaatatttaaaacaaaagaaaaaggatgg
ggtgtacgttcgcttcgatttgcccctgctggcacgtttatcacttgctatttaggagaa
gtcataacttcagcagaggccgccaagcgtgacaaaaattatgacgacgacggtattacc
tatttatttgatttagacatgtttgatgatgctagcgagtatacagtggatgctcagaac
tatggagatgtctctcgtttttttaaccactcctgttcacctaatatagctatttattct
gctgttcggaaccatggatttcgaaccatttatgatctcgctttttttgccatcaaagac
attcagcctctagaggagcttacatttgattacgctggtgcaaaagatttctcacctgtt
caatctcaaaaatctcagcaaaatagaatttcaaaacttcgccggcagtgcaaatgtggt
tccgctaattgtcgtggctggcttttcggttaa

DBGET integrated database retrieval system