KEGG   Schizosaccharomyces pombe (fission yeast): SPBC543.07Help
Entry
SPBC543.07        CDS       T00076                                 

Gene name
pek1, mkk1, skh1
Definition
MAP kinase kinase Pek1
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    SPBC543.07 (pek1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     SPBC543.07 (pek1)
Protein kinases [BR:spo01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   SPBC543.07 (pek1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:4312763..4313854
Genome map
AA seq 363 aa AA seqDB search
MSKKPVLNLDTSNGFSEEYISHPERNDNQGIVEITDLVFSSESKLTQRKESRDSKTFVPS
FLEELDDDHLHELVTNGGILYMNSLGEGVSGSVRKCRIRGTQMIFAMKTVLAAPNTALQK
QLLRELKINRSCTSPYIVKYYGACYNNAECQLNIAMEYCGAGSLDAIYKRVRSQGGRTGE
RPLGKIAFGVLSGLSYLHDRKIIHRDIKPSNILLTSKGQVKLCDFGVSGELVNSLAGTFT
GTSYYMAPERISGGSYTISSDIWSLGLTLMEVALNRFPFPPEGSPPPMPIELLSYIINMP
PPLLPQEPGIKWSKSFQHFLCVCLDKDKTRRPGPQKMLTHPWVKAFERIHVDMEEFLRQV
WSD
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaaaacctgtcttgaacttagataccagtaatgggttctctgaagaatatata
agtcatcctgaacgtaatgacaatcaaggaattgtcgagattacagacctggtgttttct
agcgagtcgaaattaactcagcgaaaggagagccgggatagtaaaacatttgttccttcc
tttctggaagaacttgatgatgatcacctacatgaattggttacaaatggaggtattttg
tacatgaacagtctaggtgaaggtgttagtggctctgtaaggaaatgcagaattcgtggg
actcagatgattttcgctatgaaaactgtattagctgctccgaataccgctttacaaaag
caactccttcgagagttaaaaatcaacagaagttgtacctctccttacatcgttaaatat
tatggcgcttgctacaataacgcagagtgtcagttaaacatagctatggaatattgcgga
gcaggatctctcgacgcgatatacaaacgcgtacgcagtcaaggtggacgcactggagaa
cgaccattgggcaagattgcattcggtgtccttagcggtttaagctatttacatgacagg
aaaataatacaccgtgatattaagccatcaaatatccttctgacgtcaaaaggtcaagtg
aagttatgcgattttggtgtatctggagaattggttaactctctcgctggcacattcact
ggaacttcgtattacatggcgcctgaacgaatttctgggggatcttatactatatcgtca
gatatatggtctttgggtttaacattgatggaggtcgcattaaaccggtttccattccct
cccgagggtagccccccaccaatgcctattgaattgctctcgtatataataaatatgcca
cctccccttttacctcaagaacccggtattaaatggtcgaaatcctttcaacattttcta
tgcgtgtgtctggataaagacaaaactcgtcgtcctggaccccaaaaaatgcttacccat
ccttgggttaaagcgtttgagagaattcatgtggacatggaagagttccttcgtcaagtc
tggtctgattag

DBGET integrated database retrieval system