KEGG   Schizosaccharomyces pombe (fission yeast): SPBC577.09Help
Entry
SPBC577.09        CDS       T00076                                 

Gene name
ckn1
Definition
hypothetical protein
Orthology
K10570  
DNA excision repair protein ERCC-8
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Nucleotide excision repair
Ubiquitin mediated proteolysis
Module
Cul4-DDB1-CSA complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPBC577.09 (ckn1)
  Replication and repair
   03420 Nucleotide excision repair
    SPBC577.09 (ckn1)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   Cul4 complex
    target recognizing subunit (DCAF)
     SPBC577.09 (ckn1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      SPBC577.09 (ckn1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(767782..767818,767869..768016,768080..768187,768268..768385,768434..768512,768557..769281)
Genome map
AA seq 404 aa AA seqDB search
MNSFLLAREWGQEPNSSFRRQLLQHRLQRLALNPDVKIKRRHGAGILGSVNALSIDNTIH
QLMVSGGANSSINVWDLQNIDQKEDEDLILDTLNAVPARTSHKFGITDLHWFPFDNGIFT
SSSFDHTLKVWDVSTLQEAYTFTMEDMIYSHAWSPIASHCLIATAYRSSSIRLCDMQSGS
YTHSLSGHTGNVLAVDWCPKNEFVLASGSADGTCRLWDIRKVSSSFACMDLHNKYLPSNQ
TNISHYGTVNGLAWTSDARYLASCGTDDRIRVWNMESGRNTLREFGPIIHNQTTSFAVHP
CMIQPSMDSDVFVLFPNDDGSLALLNLLEGSFVRRLSTHSLKRINCAAYRPDFEQCFTGD
MNGNIYMWSPKALKSPTKISDLETRRNIIQEVYDSLINIPVTYQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaattcttttttattggcacgagaatggggccaagagccaaatagctcttttcgaagg
caactactgcagcatcgtcttcaacggttagcgctgaatccggatgtgaaaattaaacgt
agacacggtgcgggcattttaggatccgtaaatgcactaagcattgataatacaattcat
cagctcatggtctctggaggagccaactcgtctatcaatgtttgggacctacaaaatatt
gaccaaaaggaagatgaagatttaattttggataccttaaatgcagttcctgctcgaacg
agtcataagtttggaataacagatttgcattggtttccgtttgataatggtatttttact
agctcgtcgttcgatcatacgctcaaggtttgggatgtttctactttacaggaagcttac
acttttactatggaggacatgatttattcacatgcatggtcgcccattgcatcacattgt
ttaattgccaccgcctaccggtcttcgtctattcggctttgtgatatgcaaagtggtagt
tatactcatagtttgtctggacacacgggtaatgtccttgcggtggattggtgtcctaag
aatgaattcgtgttagcgtccggctctgcagatggcacttgcagactttgggacattcgt
aaagtatcatccagcttcgcatgtatggatctacataataagtatttacccagtaaccag
acaaatatatctcattacggcaccgttaatggattagcttggacttcagatgctcgatat
ttggcaagttgtggtaccgacgatcgaataagagtatggaatatggaaagtggaagaaac
acattgagagaatttggacctattattcataaccagactacttccttcgcggtacatcct
tgcatgatccaaccctctatggattcagatgtttttgtgttattccccaacgatgatggg
tctcttgccttattgaacttgttagaaggctcgtttgtgcgccgactttcaacccacagt
ttaaaacgtattaattgtgctgcctatcgtcctgactttgaacagtgttttactggtgat
atgaatgggaacatttacatgtggtctcctaaagctctaaaatcgcctacgaagatttcg
gatttagaaacaagacgaaacataattcaagaagtatacgactctttaattaatattcca
gtgacttatcaataa

DBGET integrated database retrieval system