KEGG   Schizosaccharomyces pombe (fission yeast): SPBC6B1.06cHelp
Entry
SPBC6B1.06c       CDS       T00076                                 

Gene name
ubp14
Definition
ubiquitin C-terminal hydrolase Ubp14
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SPBC6B1.06c (ubp14)
Peptidases [BR:spo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SPBC6B1.06c (ubp14)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPBC6B1.06c (ubp14)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(join(2637613..2639844,2639914..2640009))
Genome map
AA seq 775 aa AA seqDB search
MSCPHLTETNVVIPDNSQVIYREECVRCFNSQDEEGGIDLCLTCFQSGCGETGLKHSLVH
FEQTLHPIVVTIARQPKQKINDEPPQKITKLEIREDSDEDLYDYFYVPKCLVCNIILDIQ
DPLLSLSLEAMKNATKASNKSQLTAWENELTTCDHIINLPENETYVTNLDNATCSKCDLA
ENLWMCLTCGALSCGRKQYGGGGGNGHALSHYDDTGHPLAVKLKSISPDGQADIYCYSCD
EERIDPNIKTHMLNFGIDIAKLNKTEKSLAELQLEQNLNWDFGASEEDDASKRLFGPGLT
GLKNLGNSCYLASTMQSLFSIKEFAIHELNLFNTYNSVCQTPTTDLQCQLGKLADGLVSG
KFSKPSKIGLLNNPSSSILPYQDGLRPFMFKDVVGQGHSEFGTSQQQDAYEFLLYLLGKI
RKSSIAKTDITKIFDFETEQKLSCLSCKRVRYSSFSSQGLTLTVPRVKIGEIEGEQIYEE
VSIDQCLDATIQPDQMEYTCEACKSKLGATTTTAMKSFPKVLILQANRFDLQGYQVKKLS
IPIIVNEDGIYNFDRLMAKDHPNDEDYLPEKTETIEWNQSAIEQLQAMGFPLVRCQRALL
ATGNSDTETAMNWLFEHMEDPEIDKPIEVSELLPKADSSVSEENVQSLCEFGFTVAQARK
GLLESNNNIERAVDWILNHPDESFEEPPLEGSDSSIKNENMGSWESTNVPVNYNLKAIIS
HKGSSAHAGHYVAFIRKEIDGKQQWVLFNDEKVLQVASLEEAKTTGYVYLFERLD
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgtccgcacctcacagagacaaacgttgtaatcccagataattctcaggtaata
tatcgtgaagaatgcgtccgttgctttaattcgcaggatgaagaaggtggaattgattta
tgcttaacctgttttcaatctggatgtggggaaactgggttaaaacactcacttgtccat
tttgaacaaactttgcacccaattgtggtcaccattgccaggcaacctaagcaaaaaatt
aatgatgagcctccccaaaaaattacgaaacttgagatcagagaagatagtgatgaagat
ttatatgattatttttatgtccctaagtgtttggtctgtaatataatattagatatacag
gatcccttactttcgttatcattagaggcaatgaaaaatgctaccaaggcatcaaacaaa
agtcaattaactgcatgggaaaatgaattaactacttgtgatcatataataaatttacca
gaaaatgaaacttacgtcacaaatttggacaatgctacatgttcaaaatgtgatcttgca
gaaaatctatggatgtgtttaacatgtggcgcattaagctgtggaagaaaacagtacgga
ggaggtggtgggaatgggcacgccctttctcattatgatgatacaggacatccgcttgca
gttaaactcaaaagcatttcacctgatggtcaggctgatatatattgttatagttgcgat
gaggaaagaattgacccaaatataaagacacatatgctaaatttcggcatcgatatcgcc
aagttgaacaaaactgaaaaatctttggctgaactacaattagagcaaaatttaaattgg
gattttggtgcctccgaagaggatgacgcttcaaaaagattgtttggaccaggattaact
ggtcttaaaaatcttggtaatagctgttatctggcctcaactatgcagtcgttgttttct
attaaggaatttgctattcacgaattaaaccttttcaacacttataattctgtttgtcaa
acccccactacagatttgcaatgtcaacttggtaaactagctgatggtttagtaagtggg
aaattttctaaacctagcaaaattggtttactcaataatccttcttcatcgattcttcct
taccaagatggtttgaggccttttatgttcaaagatgttgtgggacaagggcattctgaa
tttggaacttctcaacagcaagatgcttatgagtttttattgtatttgctggggaaaata
cggaaatctagtattgcgaaaactgacattactaagatttttgactttgaaacggagcaa
aaattatcttgtctttcctgtaaacgcgttcgctattcttctttctcttctcagggattg
actttgacagttccgcgtgttaaaattggtgaaattgagggtgagcaaatttatgaagaa
gtctcaatagaccaatgtttagatgcaactatacaaccagaccaaatggagtatacttgt
gaagcttgtaaaagtaaactaggagctacaactactactgccatgaagtcgttcccgaaa
gtcttgatcctacaagccaaccggtttgatttacagggatatcaagttaagaaattaagc
atccctataatagttaatgaagacggaatttataatttcgatcgcttaatggctaaggac
cacccaaatgacgaagattatcttcctgaaaagacagagaccattgaatggaaccaaagt
gctattgaacagcttcaagctatgggatttcctttagtcagatgccaacgagcattactc
gctactggaaattctgatactgaaactgccatgaactggctatttgaacatatggaggac
cctgaaattgacaaacctattgaagtttctgaattactgcccaaagcagactcaagtgtt
tcagaagaaaatgttcaatcattatgtgaattcggctttactgttgcacaagcacgaaaa
ggattgcttgaatctaacaataatattgagcgcgcagttgattggattttaaatcatccg
gatgaaagttttgaagaaccaccacttgaaggatcagattcttcaataaaaaatgaaaat
atgggtagttgggaatcgacaaacgttccagtcaactacaatttaaaggccataataagc
cataagggctcaagtgcgcatgccggtcattatgtagcatttatacgcaaagagatagat
ggaaagcagcaatgggttttgtttaatgatgaaaaggtgcttcaagttgcctccttggaa
gaagcaaaaactaccggatatgtctatctttttgaaaggctagattga

DBGET integrated database retrieval system