KEGG   Schizosaccharomyces pombe (fission yeast): SPBC776.02cHelp
Entry
SPBC776.02c       CDS       T00076                                 

Gene name
dis2, bws1, sds1
Definition
serine/threonine protein phosphatase PP1 (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
mRNA surveillance pathway
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:spo03015]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:spo04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(join(3173719..3174650,3175047..3175098))
Genome map
AA seq 327 aa AA seqDB search
MSNPDVDLDSIIDRLLEVRGSRPGRQVQLSEDEIRFLCNKAREIFISQPILLELEAPLKI
CGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLEVICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLN
SMDQIQRIMRPTDVPDTGLLCDLLWSDPDKDLTGWGDNDRGVSFTFGPDVVSRFLHKHDM
DLVCRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEK
KQRYGYQGSSQNWHMTPPRKNKTGNSK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacccagatgtggatttggattccattatcgaccgcttgttagaagtccgtggt
agtcgtccaggtagacaggttcaattatctgaagatgaaatacgatttttatgtaacaaa
gcacgtgaaatatttattagtcaacctatccttctagagcttgaagctcctttgaaaatt
tgtggagatattcatggccaatattacgatcttcttcgactttttgagtacggaggattc
cctccagaagccaactatctgtttctaggtgattatgttgacagaggaaaacaaagcttg
gaagtaatttgtcttttgctcgcttataaaatcaagtaccccgaaaatttttttatttta
cgtggaaatcatgaatgcgccagtattaatcgtatctatggattttacgatgaatgtaag
cgccgttataacattaagttatggaaaacatttacagattgcttcaactgccttcctata
gcagctatcattgatgaaaaaatttttactatgcatggaggtctttcgccagatttgaac
tctatggaccagatccaaagaatcatgcgaccgaccgatgtccctgatactgggttactc
tgtgatttactttggtctgatcctgacaaggatcttacaggctggggtgataatgataga
ggtgtttctttcacgtttggacctgatgttgtctctcggtttttgcacaaacacgatatg
gatcttgtttgccgagcccatcaggttgtggaagacggttatgagttcttctctaaacgt
cagctagtcacattgttcagtgcacctaattactgtggcgagtttgataatgcaggtgcg
atgatgagtgttgacgagagcttgttgtgcagtttccagattttgaaaccggctgaaaaa
aaacaacgctacggataccaaggttcaagtcaaaattggcacatgactccacctcggaag
aataagacaggaaattcaaagtaa

DBGET integrated database retrieval system