KEGG   Schizosaccharomyces pombe (fission yeast): SPBC776.15cHelp
Entry
SPBC776.15c       CDS       T00076                                 

Gene name
kgd2
Definition
dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPBC776.15c (kgd2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPBC776.15c (kgd2)
  Amino acid metabolism
   00310 Lysine degradation
    SPBC776.15c (kgd2)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SPBC776.15c (kgd2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(join(3206869..3208034,3208095..3208166,3208459..3208579))
Genome map
AA seq 452 aa AA seqDB search
MTSYGNGFRMMAKCLLSLRSGYSVTAPVSKSMANVLWARYASTRIKTPPFPESITEGTLA
QWLKQPGEYVNKDEEIASVETDKIDAPVTAPDAGVLKEQLVKEGDTITIDQDIAVIDTSA
APPEGGSAGPKKDEVKTADADAAKDLSTPQDSSKPIEEKPMPDLGAEQKESAPSSTKPAP
DAKEPEFSSPKPKPAKSEPVKQSKPKATETARPSSFSRNEDRVKMNRMRLRIAERLKESQ
NRAASLTTFNECDMSAVVALRKKYKDEILKETGVKIGFMSFFSKACTQAMKQIPAINGSI
EGEGKGDTLVYRDFCDLSIAVATPKGLVTPVIRNAESMSLLEIESAIATLGSKARAGKLA
IEDMASGTFTISNGGIFGSLYGTPIINLPQTAVLGLHAIKERPVVINGQVVPRPMMYLAL
TYDHRMVDGREAVTFLRLVKEYIEDPAKMLLV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgacttcttacggcaatggctttcgcatgatggcgaaatgtcttttatctctacgttca
ggatattcagtcactgctccagtgtctaaatccatggccaacgtcctttgggcccgttat
gccagtacacgcattaaaacgcctccgtttcctgaatctattacggaaggtaccctcgca
caatggttaaaacaacctggagaatatgtcaacaaggatgaggaaatcgcgagtgtggaa
actgataaaattgatgcccccgttacagctcctgatgccggtgttttaaaggaacaactc
gttaaagaaggtgacactattaccattgatcaggatattgcggtcattgatacgagtgcc
gctcctcctgaaggcggtagtgccggtccaaagaaagatgaagtcaaaactgcagatgcc
gatgcagctaaggacctttcaactcctcaagattcttctaaacccattgaagagaaaccc
atgcctgacctcggtgctgaacaaaaggaatctgcaccttcctctactaagcctgctcct
gatgccaaagaacctgaattttcttctcctaagcctaaacctgccaaatccgaaccagtt
aaacaaagtaagcctaaagctacagagaccgctcgtccttcctcattttcccgtaatgag
gatcgtgttaaaatgaatcgcatgcgtcttcgtatagctgagcgccttaaggagtcccaa
aatcgtgcggcttctctcactactttcaacgaatgtgacatgtctgctgtggtcgccctc
cgtaagaaatacaaggatgaaattttgaaggaaaccggtgttaaaattggattcatgagt
tttttctctaaggcttgcacccaagctatgaagcaaattcctgcaatcaatggctccata
gaaggtgaaggaaagggtgatactcttgtttatcgcgacttttgtgatctcagcattgct
gttgctacccctaaaggtttagttacaccggtcattcgtaatgctgaaagcatgtccctt
ttggaaattgaaagtgctattgcaactttgggttcaaaagcgcgtgctggcaaattagct
attgaggacatggctagtggaactttcaccatctctaatggtggtatttttggctccctc
tatggtacccctattatcaatcttcctcaaacagctgtattgggtttgcatgccattaag
gaacgacctgttgttatcaacggccaagttgttccaaggccgatgatgtatttggctctt
acttatgaccatagaatggttgatggtcgtgaagcagttactttcttgcgtttagtaaag
gaatatattgaagatcctgcaaaaatgctattagtataa

DBGET integrated database retrieval system