KEGG   Schizosaccharomyces pombe (fission yeast): SPBC887.01Help
Entry
SPBC887.01        CDS       T00076                                 

Definition
acireductone dioxygenase family (predicted)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SPBC887.01
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     SPBC887.01
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     SPBC887.01
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:3540222..3540758
Genome map
AA seq 178 aa AA seqDB search
MRAYIFQDEGDQRKPNDSKIEVSAEDLEAAKVSYRHHDGDLHTFADGLMKEYGFKNRDEV
VVSRKGLGDRYDNMVKKFFEEHLHEDEEIRLILDGNGYFDVRSVDDRWVRIFVEKGDLII
LPPGIYHRFTTTTDDYIHAMRLFHENPKWIALSRTDSTSEELDARKSYLNSIKKSVYV
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgagagcatacattttccaagacgaaggcgatcaaagaaagccgaatgactcaaagatt
gaagtttcagctgaagatttagaagctgctaaagtgtcctatagacatcatgatggagat
ctacataccttcgccgatggccttatgaaagaatatggatttaaaaatcgggatgaagtt
gttgttagtagaaaaggacttggagatcgttatgacaatatggtaaagaagttctttgaa
gaacatttgcacgaagatgaggaaattcgattaattctcgatggtaatggttactttgat
gtccgttctgtcgatgatagatgggttcgaatttttgttgagaaaggcgacttaataata
cttcctcctggaatttatcatcgttttactacgaccactgatgactatatacacgcaatg
cgcttgtttcatgaaaatccaaaatggattgcattgtctcgcacagattcaaccagcgag
gaactggatgcacgaaaaagttatttgaacagtattaaaaaaagtgtttatgtttaa

DBGET integrated database retrieval system