KEGG   Schizosaccharomyces pombe (fission yeast): SPBC8D2.07cHelp
Entry
SPBC8D2.07c       CDS       T00076                                 

Gene name
sfc9
Definition
transcription factor TFIIIC complex subunit Sfc9 (predicted)
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     SPBC8D2.07c (sfc9)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     SPBC8D2.07c (sfc9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(join(1372610..1374338,1374538..1374625,1374684..1374780,1374828..1374935))
Genome map
AA seq 673 aa AA seqDB search
MGKDVALDFLPSSLYSCTCSCDGKLAFCDSEKVQILVPSTEANTPKFMKALAYLDDVEDE
LPNCQMLAPNELRLGDLTPSVISRYVVWSPTGLADNYDPLLTVLTNRHRVYFFSSSSRVL
HQKWTCVAQMSTHLPSDPLELCRIHSVAWSPLVSLPSSSPWGVCLFALGAESGHVHLSIM
SHSSTPFFKSFDLNCSWVVQLSFSSWNVVGDSATCLLSCSSRNGEIRILKIAISSHSDTF
DTAMQELPFSLDYRPFSPLLAWSSPLANVEYLALVYPGHLFAFRYDKSLGKFCSFLNHNL
LSLCSPSGVLFGHNDIDTIYVYILTHSGTLETFSLLDNSISMLDSPERHVLEKFLNNHLQ
NYGSVSDDSIKTLKIHGFCPSPYLSSAALHFSISYPASFTYVVTAAERSYFNFIPSLFSK
SVFSHMITSSLNNLCVAPSAGCLLEISLMNDTLKEKTDIFTMLTNSLSSFLVTDYDFFLE
LKHLIDISSLSNLYLDSSLNAMRLLYGWSVYKQKALDATLLNSLRYRLTLYIMLYTLSQI
SLDPSYLTSDCKAVLRNFVSFTYKELAEVPIAMEVANEIAKSLEVSSDFSETCPACEATV
QFNNTSLATCDNGHVWRRCSVTMLLLSQKAAKYCAVCNSIVAIFNPSQTKCLLADLQNEL
SICFYCGGHFLVS
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggatgtagcattggattttcttccatcaagcttgtatagctgtacttgttct
tgcgatggaaaattggctttttgcgattcagaaaaagtccaaatcttggtaccttcaact
gaagccaatacgcctaagtttatgaaggcgctagcctatttagatgatgtggaagatgaa
ctaccaaattgccaaatgcttgctcctaatgagcttcgtttaggagatctaactccaagt
gtcataagccgctatgtggtctggtcgccaacaggtctcgcagacaattacgatccattg
ttaactgttttaactaatcgtcatcgtgtgtatttcttttcttcatctagtcgcgttctc
catcaaaaatggacttgcgtggcacaaatgagtactcacttaccttccgatcctttggaa
ctttgccgaattcatagcgttgcatggtcgcctttggtaagtcttccttcatcttcacct
tggggcgtgtgtttgtttgcacttggtgcagagtcgggtcatgtccatctctctattatg
tcacattcatctaccccatttttcaagtcttttgatttgaattgctcatgggtagttcag
ttatcattctccagctggaatgtggttggggattcagctacctgtttgctatcgtgttct
tctcggaatggagaaatccgaattttaaaaatagctattagctctcattctgacactttt
gataccgctatgcaagagctacctttctcgttggactatagaccgttttctcctctgcta
gcctggtcatctccattagccaatgttgaataccttgcgttagtttatcctggccattta
tttgcatttcggtatgacaagtcattagggaagttttgctcttttttgaaccataatctt
ttgtccctttgctctccttctggagtgttgtttggtcataacgacattgataccatatat
gtttacatcttgacacattctggaactttagagactttttccttgttggataattcaata
tcgatgttggactcaccagagagacatgtgcttgaaaaatttttgaacaatcacttgcaa
aattatggctctgtttcagatgattcaataaagacccttaaaatccatggcttttgccct
tctccttacttatcctctgctgctctccactttagtatatcgtacccggcctcatttact
tacgttgtaacagcagctgaacgaagttattttaatttcattccatctcttttttcaaaa
tccgttttttcacacatgattacttcttcacttaataacctatgtgtagcaccttcagcc
ggttgtttactcgaaatttctttaatgaatgacacattaaaagaaaaaacggatattttt
acaatgcttacaaattccttatcaagttttttagttacggattatgattttttccttgag
ctaaagcatcttatagatatatcctctctttcaaatttgtatttagactcttcattgaat
gcaatgagacttttatatggttggagcgtttataaacaaaaagcattagacgctacttta
ctgaattctttgagataccgattaaccctatacattatgttatatacactttctcagata
tctcttgacccctcttatctaactagtgattgcaaagctgttttaagaaactttgtatca
tttacttataaagagttggctgaggtaccgattgcaatggaagtagcgaacgagatagca
aaaagcttggaagtttcctcagattttagtgaaacttgcccagcatgtgaagctacagtt
caattcaataatacatcattagctacatgtgataatggacacgtctggagacgttgctca
gtcaccatgctacttttatctcaaaaagctgcgaaatattgtgctgtgtgcaacagtata
gtggccatttttaaccctagccaaaccaaatgcttacttgcagatcttcaaaatgagctt
tctatttgcttctattgcggtggacatttcttggtttcgtaa

DBGET integrated database retrieval system