KEGG   Schizosaccharomyces pombe (fission yeast): SPBC8D2.07cHelp
Entry
SPBC8D2.07c       CDS       T00076                                 

Gene name
sfc9
Definition
(RefSeq) transcription factor TFIIIC complex subunit Sfc9 (predicted)
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(join(1372610..1374338,1374538..1374625,1374684..1374780,1374828..1374935))
Genome map
AA seq 673 aa AA seqDB search
MGKDVALDFLPSSLYSCTCSCDGKLAFCDSEKVQILVPSTEANTPKFMKALAYLDDVEDE
LPNCQMLAPNELRLGDLTPSVISRYVVWSPTGLADNYDPLLTVLTNRHRVYFFSSSSRVL
HQKWTCVAQMSTHLPSDPLELCRIHSVAWSPLVSLPSSSPWGVCLFALGAESGHVHLSIM
SHSSTPFFKSFDLNCSWVVQLSFSSWNVVGDSATCLLSCSSRNGEIRILKIAISSHSDTF
DTAMQELPFSLDYRPFSPLLAWSSPLANVEYLALVYPGHLFAFRYDKSLGKFCSFLNHNL
LSLCSPSGVLFGHNDIDTIYVYILTHSGTLETFSLLDNSISMLDSPERHVLEKFLNNHLQ
NYGSVSDDSIKTLKIHGFCPSPYLSSAALHFSISYPASFTYVVTAAERSYFNFIPSLFSK
SVFSHMITSSLNNLCVAPSAGCLLEISLMNDTLKEKTDIFTMLTNSLSSFLVTDYDFFLE
LKHLIDISSLSNLYLDSSLNAMRLLYGWSVYKQKALDATLLNSLRYRLTLYIMLYTLSQI
SLDPSYLTSDCKAVLRNFVSFTYKELAEVPIAMEVANEIAKSLEVSSDFSETCPACEATV
QFNNTSLATCDNGHVWRRCSVTMLLLSQKAAKYCAVCNSIVAIFNPSQTKCLLADLQNEL
SICFYCGGHFLVS
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggatgtagcattggattttcttccatcaagcttgtatagctgtacttgttct
tgcgatggaaaattggctttttgcgattcagaaaaagtccaaatcttggtaccttcaact
gaagccaatacgcctaagtttatgaaggcgctagcctatttagatgatgtggaagatgaa
ctaccaaattgccaaatgcttgctcctaatgagcttcgtttaggagatctaactccaagt
gtcataagccgctatgtggtctggtcgccaacaggtctcgcagacaattacgatccattg
ttaactgttttaactaatcgtcatcgtgtgtatttcttttcttcatctagtcgcgttctc
catcaaaaatggacttgcgtggcacaaatgagtactcacttaccttccgatcctttggaa
ctttgccgaattcatagcgttgcatggtcgcctttggtaagtcttccttcatcttcacct
tggggcgtgtgtttgtttgcacttggtgcagagtcgggtcatgtccatctctctattatg
tcacattcatctaccccatttttcaagtcttttgatttgaattgctcatgggtagttcag
ttatcattctccagctggaatgtggttggggattcagctacctgtttgctatcgtgttct
tctcggaatggagaaatccgaattttaaaaatagctattagctctcattctgacactttt
gataccgctatgcaagagctacctttctcgttggactatagaccgttttctcctctgcta
gcctggtcatctccattagccaatgttgaataccttgcgttagtttatcctggccattta
tttgcatttcggtatgacaagtcattagggaagttttgctcttttttgaaccataatctt
ttgtccctttgctctccttctggagtgttgtttggtcataacgacattgataccatatat
gtttacatcttgacacattctggaactttagagactttttccttgttggataattcaata
tcgatgttggactcaccagagagacatgtgcttgaaaaatttttgaacaatcacttgcaa
aattatggctctgtttcagatgattcaataaagacccttaaaatccatggcttttgccct
tctccttacttatcctctgctgctctccactttagtatatcgtacccggcctcatttact
tacgttgtaacagcagctgaacgaagttattttaatttcattccatctcttttttcaaaa
tccgttttttcacacatgattacttcttcacttaataacctatgtgtagcaccttcagcc
ggttgtttactcgaaatttctttaatgaatgacacattaaaagaaaaaacggatattttt
acaatgcttacaaattccttatcaagttttttagttacggattatgattttttccttgag
ctaaagcatcttatagatatatcctctctttcaaatttgtatttagactcttcattgaat
gcaatgagacttttatatggttggagcgtttataaacaaaaagcattagacgctacttta
ctgaattctttgagataccgattaaccctatacattatgttatatacactttctcagata
tctcttgacccctcttatctaactagtgattgcaaagctgttttaagaaactttgtatca
tttacttataaagagttggctgaggtaccgattgcaatggaagtagcgaacgagatagca
aaaagcttggaagtttcctcagattttagtgaaacttgcccagcatgtgaagctacagtt
caattcaataatacatcattagctacatgtgataatggacacgtctggagacgttgctca
gtcaccatgctacttttatctcaaaaagctgcgaaatattgtgctgtgtgcaacagtata
gtggccatttttaaccctagccaaaccaaatgcttacttgcagatcttcaaaatgagctt
tctatttgcttctattgcggtggacatttcttggtttcgtaa

DBGET integrated database retrieval system