KEGG   Schizosaccharomyces pombe (fission yeast): SPBC8E4.03Help
Entry
SPBC8E4.03        CDS       T00076                                 

Definition
agmatinase 2 (predicted) (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:spo00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(4434367..4435608)
Genome map
AA seq 413 aa AA seqDB search
MFTYQKIIQLALLLSGVCGALASIDTDSHLSPKVLEKLRPTENLAYEDDSLDDDTWRSKR
WEFDYQYSGISTFAHLPHVRCLVEQSEDFDIAIIGVPFDTAVSHRPGARFGPKGIRSASS
RQMAIRGFNPSLNVNPYESWAKILDCGDIPVSSYDNQLAVRQMTEGYIDLLSRKATASPA
SNNLKTAGLAKDGIFHPRLITLGGDHSIGLASLRALGHFYGNVSVIHFDSHLDTWNPKRY
YPSYWHSDRADFTHGTMFWMASKEGLINNGTSIHAGLRTRLSGTDYYDYEEDNRVGFTFI
EAQEIDEIGVNGIVERIKQVVGDTLVYLSIDIDVVDPGLAPGTGTPETGGWTTREMKSIL
RKLDGHLNLVGAEVVEVSPPYDDRAESTSLAASDFIFEILSSMVKHPLYDVKK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtttacttatcaaaaaattattcaacttgctttactcctttcaggcgtatgtggcgct
cttgccagcatagacactgattcacatttgtcgccaaaagtccttgaaaaactgagaccg
acagagaaccttgcatacgaggatgacagtctagatgatgacacatggcgttccaagaga
tgggagtttgattatcagtattctggtatatctacctttgctcatttgccgcatgtaaga
tgtttggttgagcaatcagaagactttgatatagccataataggcgtcccgttcgatacg
gccgtgtcacatcgtcccggtgcacgtttcgggcctaaaggtattcgttcagcctcttcc
cgtcaaatggcaattaggggttttaacccctcgttgaatgtcaatccttatgaaagctgg
gctaaaattcttgattgcggcgatattcccgtatcctcatatgacaatcagttagcagtt
aggcaaatgaccgaaggatatattgatctactttctcgtaaagccactgcttcccctgcg
tctaacaatcttaaaacggcgggattagccaaagatggaatttttcatcctcgacttatt
acactaggtggggatcattcaataggccttgcatctttaagagcactaggtcatttttat
ggaaatgttagtgttattcatttcgactcacatttggacacatggaatccaaagagatat
tatccttcttactggcattccgatcgagcagatttcactcatggaacaatgttttggatg
gcaagtaaagagggtttgatcaacaacggcacatccattcacgccggtttacgaactcgc
ctaagtggaaccgattactatgactacgaagaggataaccgagtcggatttacctttatt
gaagcgcaagaaattgacgaaatcggggttaatggtatcgtcgagcgtattaagcaagtc
gttggagacactcttgtttatttaagtattgacattgatgttgtcgatcctggattggca
cctggaactggtactcctgaaacgggtgggtggactacacgagaaatgaagagcattctt
aggaagctggacggacacttgaacctcgtaggtgctgaggtggttgaagtgtctcctcct
tacgatgaccgtgctgaaagtacatctttggcagcttcagatttcatctttgagatactg
tcgagcatggtgaagcatccattatacgatgtaaaaaaataa

DBGET integrated database retrieval system