KEGG   Schizosaccharomyces pombe (fission yeast): SPBP16F5.02Help
Entry
SPBP16F5.02       CDS       T00076                                 

Gene name
mcs2
Definition
TFIIH complex cyclin Mcs2
Orthology
K06634  
cyclin H
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    SPBP16F5.02 (mcs2)
  Replication and repair
   03420 Nucleotide excision repair
    SPBP16F5.02 (mcs2)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SPBP16F5.02 (mcs2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(1893156..1893428,1893515..1893588,1893641..1894262)
Genome map
AA seq 322 aa AA seqDB search
MSADKFRDSTHYRDWIFTEEDLSKTRAKVNEKFTNIVRERMLEELSLQNKEASLEVLPPT
LTVEEELELVNYYSFQLNALSSALSLPTHIRSTAILFFKRFYLINSVMEYSPKIISFTSL
FLATKCNDHYISIEQFCKNMPKTTPEEVLEYEFNVCQSLKWDLYVWLPFRPLQGFLLDCQ
TVLPKVAVEKFYECHDLSKKFLIETLHSDIYFLHSPSIIALGAIYHTNPTICLQYIEAKK
IPELQPLIISISANLKATKKFKIEKKKAQDYGRKLYFCMNPLRNKSSALYLKRKAEEEST
NNNKWAKKFSTSSNVLDKNPFE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgataaatttcgtgattccacgcattacagagattggatttttacggaagaa
gacctttcaaaaacacgtgctaaagtaaatgaaaaatttacgaatattgtacgtgagcga
atgctggaagagttgtctttacaaaacaaggaagcatccttagaagttttgcctccaact
cttaccgttgaagaagaacttgaacttgtaaattattatagtttccagttgaacgcactt
tcttccgctctttccttaccaactcatattcgctccacggccattcttttttttaaacgc
ttttatctaattaactctgtcatggagtatagtccaaaaattatttcgtttacttcttta
tttttagctaccaagtgcaacgatcattatatctctattgaacaattctgtaaaaacatg
cccaagacgactcccgaagaagttcttgaatacgaatttaacgtttgtcaatcattaaaa
tgggacctttacgtctggcttccatttcgtcctttacaaggcttccttttagattgtcaa
acagtgcttccgaaagttgctgtcgaaaagttttacgaatgtcatgacctttccaaaaaa
ttcctaattgagacattgcattctgacatctatttcttacattcacccagcataattgct
ttgggtgctatttatcatacgaatccaactatttgtttacaatatatagaagcaaaaaaa
attccagaactgcaacctttgataatttcgatttctgccaatttgaaagctacaaaaaaa
tttaagattgagaaaaaaaaggcacaagattacggcagaaagctatatttctgcatgaat
cctctgcgaaacaagtctagtgctttgtaccttaaacgaaaagcggaagaagaatcaact
aataacaacaaatgggctaaaaagttctcaaccagcagtaatgtgttggataaaaatccg
tttgaatga

DBGET integrated database retrieval system