KEGG   Schizosaccharomyces pombe (fission yeast): SPBP16F5.04Help
Entry
SPBP16F5.04       CDS       T00076                                 

Gene name
ubc7, ubcP3
Definition
(RefSeq) ubiquitin conjugating enzyme Ubc7/UbcP3
  KO
K04555  
ubiquitin-conjugating enzyme E2 G2 [EC:2.3.2.23]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPBP16F5.04 (ubc7)
   04120 Ubiquitin mediated proteolysis
    SPBP16F5.04 (ubc7)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     SPBP16F5.04 (ubc7)
Ubiquitin system [BR:spo04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   SPBP16F5.04 (ubc7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(1905799..1905987,1906384..1906441,1906491..1906744)
Genome map
AA seq 166 aa AA seqDB search
MSKAMALRRLMKEYKELTENGPDGITAGPSNEDDFFTWDCLIQGPDGTPFEGGLYPATLK
FPSDYPLGPPTLKFECEFFHPNVYKDGTVCISILHAPGDDPNMYESSSERWSPVQSVEKI
LLSVMSMLAEPNDESGANIDACKMWREDREEYCRVVRRLARKTLGL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagctatggcgttgcgacggttaatgaaggagtataaggagttaacggagaat
gggcctgatggtattactgcaggtccatcgaatgaggatgatttctttacttgggattgc
ctaattcaaggccctgatggaactccatttgaaggtgggttataccctgctaccttgaaa
tttccttccgattatcctcttggcccccctactttaaagtttgagtgtgaatttttccat
ccaaatgtttacaaagatgggacggtttgcatttccatcctacatgcacctggtgacgat
ccaaatatgtatgagtcgtcttcagaacgttggtctcctgttcaatctgttgaaaaaata
ctgttatcggtaatgtcgatgttggcggaaccaaacgatgaaagtggtgctaacatcgat
gcgtgcaagatgtggagagaagatcgagaagaatattgtcgtgtagttcgacgattggct
cgtaaaaccttgggattataa

DBGET integrated database retrieval system