KEGG   Schizosaccharomyces pombe (fission yeast): SPBP23A10.04Help
Entry
SPBP23A10.04      CDS       T00076                                 

Gene name
apc2
Definition
anaphase-promoting complex cullin family subunit Apc2
Orthology
K03349  
anaphase-promoting complex subunit 2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPBP23A10.04 (apc2)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    SPBP23A10.04 (apc2)
   04113 Meiosis - yeast
    SPBP23A10.04 (apc2)
Ubiquitin system [BR:spo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    Cullin
     SPBP23A10.04 (apc2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(2001135..2002370,2002415..2003034,2003080..2003269)
Genome map
AA seq 681 aa AA seqDB search
MNDTDLSTFTGRSLLIDQLSSVTQGTPVLDFIDKLRIHFYTTIRQNLLKIDLKNICSLHD
LTDQLSDFWLVYEQSVLESPILSPELDRILTCFRCLCRRYLPISVIESVLTEYLDQVLKV
WLESKTNPCLDMEKFFQLCEKFKQLGLSSVLKERFVYVLQLHVGSLLTTRYAMSWEQSVY
HEALEWIRTEFGVLVEHVFSLSNPAVLVQLDHLVSQILAHLRSDNILDIVLHYPNSLGAI
EDLRLVARQKQQRQYLTETFVKDCTSSILTASSDSSYILLFYVSTIRCFVALDPPGVLLD
KAAKPIRSFLNEREDAYKCLVSLLFVDGEKGLRSELSQIPTENIDSTTDRFDNYHWMPDP
IDAAPDFKKPTDRDVVGSLISIFKSKEPLVKELQLLLADRLLQLTDYHYEVEAKNIEFLK
YRFGETVLQMCSVMLNDIENSRFIDQSIHMENYVSKGLHVTILSRLFWPTLSVRYFHLPG
PLKKELDAYAEEYRERKRKRELVFLPNLGSVELEIELEDRTLTLTVTPEQAAFISLFEET
STLHIEKAAELLDQPKEIVERHLKFWLHHRVLTDIGDDRYRVRETEAETATETVLDEIQG
VSAVQSEAESSAAEMRVYWSFVVGMLTNLGALELERIHNMLTMFIPPPNGYTRTQSELRE
FLALMIKEEKLEFTGGAYKLK
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatactgatctgtccacctttactggccgttcgttgttgatcgatcaattgagc
tcagtcacacagggaacaccagtattggattttattgacaagttgagaattcatttctat
accactattcgccaaaatctcttaaagattgatttaaaaaacatatgcagtctacacgac
ttaacggaccaactaagtgacttttggcttgtttacgaacagagtgtcttagaaagtcct
attttaagtcctgaactcgaccgaatccttacatgcttccgttgcctttgtagaaggtac
ttgcccatttcggtgattgaaagcgttctaacagaatatctggatcaagttttaaaagta
tggttagagagtaaaacgaatccttgtttggatatggagaaattttttcaattgtgtgaa
aaatttaagcagctggggctgtcttctgtgttaaaagaaaggtttgtatatgtattgcag
ttgcatgtcggctctcttttaacaacacggtatgcgatgtcttgggagcagagtgtttac
catgaagcattggagtggattcgcaccgaatttggggttcttgttgaacatgtattttca
ttgtcgaatccagcggttttggttcagttagaccatcttgtttctcaaatacttgctcat
ttgcgatcagacaacattcttgatattgttcttcattaccccaattcactaggcgcaatt
gaagacttgcgtttagttgcccgtcaaaaacagcaacgtcaatatttaaccgaaactttt
gtgaaagattgtacaagtagtattttgaccgctagcagtgatagctcctatattcttttg
ttctatgtctctaccattcgttgttttgttgcattagacccccctggtgttcttttagac
aaagctgccaaacccattcgttcttttctaaatgaacgagaagatgcatataaatgcttg
gtttccttattgtttgttgacggtgaaaaaggcctacgctctgagctttctcaaattccc
actgaaaacatcgactcaacaacggatcgatttgataattaccactggatgccggatccg
attgatgcggctcctgactttaaaaaaccaaccgatagagacgttgttggaagtctcatt
tccatttttaaaagcaaggagcccttagtgaaggaattacaattgttactagctgatcga
cttttacaacttacagattatcattatgaagttgaggcaaaaaatatagagtttttaaag
tatcgatttggagagactgttctgcaaatgtgtagtgttatgctgaacgatattgagaat
tcaagatttattgatcagagcatccacatggagaactatgtttcgaaaggtttgcacgta
actattttatcaagattattttggcctactttgtctgttcgatattttcatttacctggc
cctctgaaaaaagaactcgatgcatatgctgaagaatacagagaaagaaagagaaaaagg
gagcttgtttttttacccaacttaggatcggtagagttggaaattgagcttgaggataga
acactcacgttgacagttacaccggagcaagctgcctttatatcactttttgaagagact
tctacattacatattgagaaagctgctgaacttttagatcagccgaaagaaatagttgag
cgacatttgaaattttggcttcatcatcgagtgcttaccgacatcggcgacgaccgatat
cgtgttcgtgaaactgaagccgaaaccgcgacagaaactgtacttgatgaaatccaaggg
gtatcagctgttcaaagtgaagccgaaagcagtgccgctgagatgcgtgtttactggtct
tttgttgtaggaatgttgacgaaccttggagctcttgagcttgaacgaattcacaacatg
ctcacgatgtttatcccaccgccaaacggctatactcgtacccagagcgagctaagagaa
tttctagcattaatgatcaaagaggaaaagttggagtttactggaggagcttataagctc
aaataa

DBGET integrated database retrieval system