KEGG   Schizosaccharomyces pombe (fission yeast): SPBP26C9.02cHelp
Entry
SPBP26C9.02c      CDS       T00076                                 

Gene name
car1
Definition
arginase Car1 (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPBP26C9.02c (car1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SPBP26C9.02c (car1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SPBP26C9.02c (car1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(324191..325162)
Genome map
AA seq 323 aa AA seqDB search
MSPHKIPEVHRHIMSSRYMEGNAVSIINMPFSGGQPKDGAELAPEMIEAAGLPEDLERLG
YSVNVVQNPKFKSRPLKEGPNQALMKNPLYVSNVTRQVRNIVQQELEKQRIAVNIGGDHS
LAIGTVEGVQAVYDDACVLWIDAHADINTPDSSPSKNLHGCPLSFSLGYAEPLPEEFAWT
RRVIEERRLAFIGLRDLDPMERAFLRERSITAYTMHDVDKYGIARVVEMALEHINPGRRR
PIHLSFDVDACDPIVAPATGTRVPGGLTFREAMYICESVAETGSLVAVDVMEVNPLLGNK
EEAKTTVDLARSIVRTCLGQTLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctcataaaatacccgaagtacatagacatattatgtctagtagatacatggag
ggaaatgccgtctctatcataaatatgccattttcaggcggtcaacccaaggacggtgct
gaattggctccagaaatgattgaggcggctggattgcctgaagacttggagcgtcttggt
tatagtgtcaacgtcgttcaaaatcccaaatttaaaagtcgacctttaaaagaaggccct
aatcaagccctcatgaaaaacccactctacgttagcaatgttactcgccaagttcgtaat
attgttcaacaggaactagagaagcaaaggatcgcggtcaacattggaggagatcattca
cttgccattggcactgttgaaggtgtacaagctgtctacgatgatgcttgtgtcttgtgg
attgatgcccatgctgatattaatacccccgattcatccccttcaaagaatcttcatggc
tgcccattgtccttttccttgggatatgccgaacctcttcctgaagagtttgcttggaca
agaagagtaattgaagagcgtcgtcttgcgttcatcggtttgcgcgatttggatcctatg
gaacgtgcttttcttcgtgaacgcagcatcactgcttacactatgcacgatgttgataaa
tatggaatagccagagtagtagaaatggcattggaacacatcaatccaggaaggagacgt
cccattcatctttcttttgacgtcgatgcctgtgatccaattgtcgctccagctactgga
acccgtgtgccaggcggtttgacctttcgtgaagcaatgtacatttgtgaaagtgttgca
gaaactggctctctagttgctgttgatgttatggaagttaacccacttttaggcaacaaa
gaggaagccaagacaactgtggatttagctcgctctattgttcgaacttgtcttggtcaa
acgttattgtag

DBGET integrated database retrieval system