KEGG   Schizosaccharomyces pombe (fission yeast): SPBP8B7.01cHelp
Entry
SPBP8B7.01c       CDS       T00076                                 

Gene name
pop7
Definition
RNAseP RNAse MRP subunit Pop7 (predicted)
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:spo03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:spo03008]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(join(3634100..3634159,3634229..3634364,3634413..3634525))
Genome map
AA seq 102 aa AA seqDB search
MSVERIKRAPAFRKGIIIRRKTHLIAMIRRMRKKLDIDGSILYQATGMAIPHLVELSDKY
KRQGYNISMDTATVEFMDEIVDEVSIQNKNRLGNVLLLRVSR
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtagaaagaattaaacgtgcgcctgcttttcgcaaaggtataattattcgaaga
aaaacacacctgattgctatgattcgacgcatgagaaagaagcttgatattgatggatct
atattataccaagctaccggcatggcaatacctcatttggttgagttaagcgataagtat
aaacgccaaggatataatatctctatggatacagctacagtcgaatttatggatgagatt
gttgatgaagtatctattcagaacaaaaaccgtttgggaaacgtattacttctccgagta
tctcgttag

DBGET integrated database retrieval system