KEGG   Schizosaccharomyces pombe (fission yeast): SPBP8B7.01cHelp
Entry
SPBP8B7.01c       CDS       T00076                                 

Gene name
pop7
Definition
RNAseP RNAse MRP subunit Pop7 (predicted)
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SPBP8B7.01c (pop7)
   03008 Ribosome biogenesis in eukaryotes
    SPBP8B7.01c (pop7)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     SPBP8B7.01c (pop7)
Ribosome biogenesis [BR:spo03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     SPBP8B7.01c (pop7)
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    SPBP8B7.01c (pop7)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    SPBP8B7.01c (pop7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(join(3634100..3634159,3634229..3634364,3634413..3634525))
Genome map
AA seq 102 aa AA seqDB search
MSVERIKRAPAFRKGIIIRRKTHLIAMIRRMRKKLDIDGSILYQATGMAIPHLVELSDKY
KRQGYNISMDTATVEFMDEIVDEVSIQNKNRLGNVLLLRVSR
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtagaaagaattaaacgtgcgcctgcttttcgcaaaggtataattattcgaaga
aaaacacacctgattgctatgattcgacgcatgagaaagaagcttgatattgatggatct
atattataccaagctaccggcatggcaatacctcatttggttgagttaagcgataagtat
aaacgccaaggatataatatctctatggatacagctacagtcgaatttatggatgagatt
gttgatgaagtatctattcagaacaaaaaccgtttgggaaacgtattacttctccgagta
tctcgttag

DBGET integrated database retrieval system