KEGG   Schizosaccharomyces pombe (fission yeast): SPBP8B7.21Help
Entry
SPBP8B7.21        CDS       T00076                                 

Gene name
ubp3
Definition
ubiquitin C-terminal hydrolase Ubp3
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SPBP8B7.21 (ubp3)
Peptidases [BR:spo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SPBP8B7.21 (ubp3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:join(3677713..3677793,3677832..3679289)
Genome map
AA seq 512 aa AA seqDB search
MRDLTSATDSASLESDSSRNQFIINSLLPWYSCSEHEFPHRKARKRRSPKNLDWSVSVQM
PLVTSKTKESEKSPKSWSAIAKKHVQGDSPVKKSHSVPVPSDRSEKKSFNSSLGELIETY
SPSLDAPRPIQPRGFINTGNICFMNSILQALMYCVPFYNLLKQINRMVPYNFERTTPLIE
SLTMLSRDFREYSEKFDLQGDSILPEVVYSATKGNPRFEMLQTGEQEDAEEFLNLFLDEL
HEEFVRERRHYLLKNDERNPKSDIKISNGIKSGLDSFDDQSSVEASGWTEVGKNKKPVIA
RSATVERSPISQIFGGQLRSTLRVPSARDSVLLEPFQPLQLDIQAEDIHSVIDALEHMTA
PEILPEWHSSKGNVTATKQMYIESLPPVLILHLKRFFYEASGGTQKNYKPIAYPARLSIP
QNVFSPSVRGSIHPEYDLNAVVYHHGTSASGGHYTVDVQQLDKSGWFRIDDTHIHRVPIH
DVENSELSADPSLSKLGHGDRVAYLLFYTRRS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcgagatttgacctctgcaacggacagcgcgtctttggaaagtgattcgtcacgaaat
caatttattatcaattcactgctaccatggtactcatgctctgaacatgaatttcctcat
cgaaaggctagaaaaaggcgttcgcctaagaatttagattggtcggtttcggtgcaaatg
cctctggtcacatcaaagacgaaagagtctgaaaaatcgcctaaatcgtggtctgcaatt
gcgaaaaagcatgttcaaggagactctcctgttaaaaaatcacattctgttccggtaccg
tctgacaggtctgagaaaaaaagtttcaattcatcccttggtgaattgatcgaaacatat
tctccatccctcgatgcaccccgtcctatacagcctcggggttttataaataccggaaat
atatgttttatgaactctattttacaggcactaatgtattgtgttccattttataattta
cttaagcaaattaaccggatggttccgtataattttgaacgtacaacacctcttattgaa
tcgttgacaatgctttctagggattttagagaatattctgagaaatttgatttacaagga
gattctattttgccagaagtggtatattcagctactaaggggaatcctcgatttgaaatg
ttgcagaccggcgaacaggaggatgctgaggagtttttgaatttgtttcttgacgaatta
catgaagaattcgtgcgtgaacgtagacattatttattaaaaaatgacgaaagaaatcca
aaatctgatatcaaaatttcaaatggtatcaagtctggtttagatagttttgatgatcaa
tcttctgtagaagctagtggctggaccgaagttggtaaaaataaaaagccagtaattgct
agatctgctactgttgaaaggtctcctataagccaaatttttggtggtcagctgcgctct
accttaagggttccgagtgcaagagattctgttttgttagaaccgtttcaacctctgcaa
ctcgacattcaagcagaagatatacattcagttatcgatgcgttggagcatatgaccgcc
cctgaaattttaccggaatggcattcgtcgaaaggaaatgttactgctaccaagcaaatg
tatatagagtcacttcctcctgtcttgattcttcaccttaaacgattcttttacgaagca
tctggcggtacacagaaaaattataagcctattgcttatcctgctcgcttgagtattcca
caaaacgttttcagcccttctgttcgtggttccatacatccggaatatgatttgaatgca
gtggtttatcatcacggtacttctgcgtctggtggtcattatactgtcgatgttcagcaa
cttgataaaagcggctggtttcggattgatgatacacacattcaccgcgtacctattcat
gatgttgaaaactccgaactttccgctgatccgagtcttagtaaacttggtcacggcgat
cgtgtggcatacttactgttttacacacgacgctcctag

DBGET integrated database retrieval system