KEGG   Schizosaccharomyces pombe (fission yeast): SPBPB21E7.04cHelp
Entry
SPBPB21E7.04c     CDS       T00076                                 

Definition
catechol O-methyltransferase 2
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPBPB21E7.04c
Enzymes [BR:spo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     SPBPB21E7.04c
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SPBPB21E7.04c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(64669..65514)
Genome map
AA seq 281 aa AA seqDB search
MFAQALHWLTTSKLRYALALPFLFFILYTKTKKSKEQELENYIFSLPREKLDQIRGKPDE
VINVIDEYVEQGHFLMNIGKLKGKIISEKIQQVKPKVMIELGGYVGYSAILFGKQLTDPS
AHYYSLEVNPKFAKIASKIIDLAGLSNKVTIIVGKATDSLVELRRSLPNVIPSFEYLDFV
FIDHWKDLYVPDLRVMETLDLIGQGSIIAADNILRPGVPEYVKYVQGSLDYRKEYDSTVS
NVNGPQFIGKWNIIYKSKTIKVDDGKREKDAVEITEYIEAK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctcaagcgctccattggttaaccactagcaaattacgttatgctttagctctc
cctttcttattttttatactatacacaaaaactaaaaaatccaaggagcaggaacttgag
aattatatattttcacttcccagagaaaaacttgatcagatacgcggaaaaccagatgaa
gttataaatgtgattgacgagtatgttgagcaaggtcatttcctgatgaatataggaaag
ttaaaaggaaaaataataagtgaaaagattcaacaagtgaagccaaaagtcatgatagag
ttaggtggttacgttggttattctgctattctgtttggaaaacaactgactgatccatct
gctcattattatagcttggaagtcaatccaaagtttgctaaaattgcgagtaaaataatc
gatttggctggattatctaataaagttactatcatcgttggaaaggcaactgattcgttg
gttgagctccgaaggagcctaccgaatgtcattccaagtttcgaatacttagattttgtt
tttattgatcactggaaagatctatacgttcctgatctcagggttatggagacgctggat
ttgataggtcaagggagcattattgctgcagataacattttgcgaccaggagtacctgag
tatgttaaatacgttcaaggatccttagactatcgtaaagaatatgacagtacagtttca
aatgtcaacggtcctcagtttattgggaagtggaatatcatttacaaatcgaaaactatt
aaagtcgacgatgggaagcgagaaaaagacgctgtcgagattaccgaatatattgaagcg
aaatga

DBGET integrated database retrieval system