KEGG   Schizosaccharomyces pombe (fission yeast): SPBPB21E7.04cHelp
Entry
SPBPB21E7.04c     CDS       T00076                                 

Definition
catechol O-methyltransferase 2
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:spo00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
II:complement(64669..65514)
Genome map
AA seq 281 aa AA seqDB search
MFAQALHWLTTSKLRYALALPFLFFILYTKTKKSKEQELENYIFSLPREKLDQIRGKPDE
VINVIDEYVEQGHFLMNIGKLKGKIISEKIQQVKPKVMIELGGYVGYSAILFGKQLTDPS
AHYYSLEVNPKFAKIASKIIDLAGLSNKVTIIVGKATDSLVELRRSLPNVIPSFEYLDFV
FIDHWKDLYVPDLRVMETLDLIGQGSIIAADNILRPGVPEYVKYVQGSLDYRKEYDSTVS
NVNGPQFIGKWNIIYKSKTIKVDDGKREKDAVEITEYIEAK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctcaagcgctccattggttaaccactagcaaattacgttatgctttagctctc
cctttcttattttttatactatacacaaaaactaaaaaatccaaggagcaggaacttgag
aattatatattttcacttcccagagaaaaacttgatcagatacgcggaaaaccagatgaa
gttataaatgtgattgacgagtatgttgagcaaggtcatttcctgatgaatataggaaag
ttaaaaggaaaaataataagtgaaaagattcaacaagtgaagccaaaagtcatgatagag
ttaggtggttacgttggttattctgctattctgtttggaaaacaactgactgatccatct
gctcattattatagcttggaagtcaatccaaagtttgctaaaattgcgagtaaaataatc
gatttggctggattatctaataaagttactatcatcgttggaaaggcaactgattcgttg
gttgagctccgaaggagcctaccgaatgtcattccaagtttcgaatacttagattttgtt
tttattgatcactggaaagatctatacgttcctgatctcagggttatggagacgctggat
ttgataggtcaagggagcattattgctgcagataacattttgcgaccaggagtacctgag
tatgttaaatacgttcaaggatccttagactatcgtaaagaatatgacagtacagtttca
aatgtcaacggtcctcagtttattgggaagtggaatatcatttacaaatcgaaaactatt
aaagtcgacgatgggaagcgagaaaaagacgctgtcgagattaccgaatatattgaagcg
aaatga

DBGET integrated database retrieval system