KEGG   Schizosaccharomyces pombe (fission yeast): SPBPB8B6.05cHelp
Entry
SPBPB8B6.05c      CDS       T00076                                 

Definition
(RefSeq) L-asparaginase (predicted)
  KO
K01424  
L-asparaginase [EC:3.5.1.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Alanine, aspartate and glutamate metabolism
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPBPB8B6.05c
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SPBPB8B6.05c
Enzymes [BR:spo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     SPBPB8B6.05c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PomBase: 
UniProt: 
Position
II:complement(54497..55567)
Genome map
AA seq 356 aa AA seqDB search
MWGFIVTCGIFLVLLCQLRLLSKRKSKSTPYNALLPNVTVFAMGGTIAGCANSSLEIVNY
IPGSVGIEKLIEAVPAIKAIANINGVQVTNMGSENLTPADVLKLAKLILAEVAKPNVHGI
VITHGTDSLEETAMFLDLTISTAKPIVVVGAMRPSTAIGADGPMNLLNAVAVASSNQSMG
RGTLVLLNDRIGSAFYTTKTNGNTLDTFKSYEAGSLGIVLNQKPFYFFSPAVPTGKVFFD
IYNIKQLPRVDILYGYQGLNPKLAESAVHLGAKGLVLAAMGATSWTDDGNEVISSLIREH
NIPVVYSHRTAEGYSSNSCLGIPSYFLNPQKARYMLMLAISSGYSIRDIEGLFSIK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtggggattcatagtaacttgtgggatttttctagtgttactatgccaattgcgttta
ctgagtaaacgcaaatcaaaatccactccttataatgccttgcttcccaatgttacagtt
tttgcaatgggtggtacaatcgctggatgcgcaaattcaagtcttgagattgtcaattac
attcccggttcggtaggaattgaaaaattgattgaggcggttccagcgatcaaggcaatt
gcaaacattaatggagtacaggtaactaatatgggaagcgaaaatttaacacctgctgat
gtcctaaaactagctaaattgattttagccgaagttgcaaaaccgaatgttcatggtatc
gtcattacacacggtaccgactccctggaagaaacagcaatgtttcttgatctgaccatc
agtactgcaaaaccaattgttgtagttggagcaatgagaccatctacggctataggcgca
gacggccctatgaatttgttaaacgctgttgctgtggcatcttccaatcaatctatggga
aggggcactttagttttattaaatgaccggattggatctgcattttacactacgaaaacg
aatggaaatacgcttgacacatttaaatcttatgaagctggatctcttgggatagttctt
aatcaaaaaccattttacttttttagtccagctgttccaaccggtaaagtgttctttgac
atttataacattaaacaactaccacgagtagacatcttatatggatatcaaggattgaat
cccaaacttgctgaatcagcagtccatctgggggccaaaggcttggttttggctgctatg
ggagcaacttcatggactgatgatggtaatgaagttatcagctcgttaatacgggaacac
aatattccagtagtgtacagtcatcggactgcggaaggatattcaagtaactcttgcctt
ggcattccttcttatttccttaatccacaaaaagctcggtacatgcttatgcttgctatt
agttcaggttattctattagagatatagaaggtttattcagcattaaataa

DBGET integrated database retrieval system