KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1223.08cHelp
Entry
SPCC1223.08c      CDS       T00076                                 

Gene name
dfr1
Definition
dihydrofolate reductase Dfr1 (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPCC1223.08c (dfr1)
   00670 One carbon pool by folate
    SPCC1223.08c (dfr1)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SPCC1223.08c (dfr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:join(1855469..1855502,1855705..1857056)
Genome map
AA seq 461 aa AA seqDB search
MSKPLKVLCLHGWIQSGPVFSKKMGSVQKYLSKYAELHFPTGPVVADEEADPNDEEEKKR
LAALGGEQNGGKFGWFEVEDFKNTYGSWDESLECINQYMQEKGPFDGLIGFSQGAGIGAM
LAQMLQPGQPPNPYVQHPPFKFVVFVGGFRAEKPEFDHFYNPKLTTPSLHIAGTSDTLVP
LARSKQLVERCENAHVLLHPGQHIVPQQAVYKTGIRDFMFSAPTKEPTKHPRDLTMIVAV
SSPNLGIGKKNSMPWHIKQEMAYFANVTSSTESSGQLEEGKSKIMNVVIMGRSCYDSLPK
KNRPLKDRINIVITRNSNYNFGLTKKEKMPENLYAADCIDSALDLVAEKYGADSDIQVGK
VFIIGGSFLYGSALYHPLTKNLLFTRIHKEYPCDSFFPFEPAESSDWVRKAHPELEKFVG
IPVEEGRLKAASSNKEEVEIEFELYGKNDDVNVALEKLSIC
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagcctttaaaagtgctgtgtcttcatggatggattcaatctggtcccgtattt
tcaaaaaaaatgggatccgtccagaaatacctgtctaagtatgccgaattgcattttcca
acaggtcctgtggtcgctgacgaagaagcagaccccaatgatgaagaagagaagaaacgc
cttgctgcgcttggtggtgaacaaaacggtggtaaatttgggtggtttgaagtggaggat
tttaaaaatacatacggaagttgggatgaaagtcttgaatgtataaatcaatacatgcaa
gaaaaaggtccctttgatggacttatcggattttctcaaggtgcaggaataggtgctatg
ctggctcaaatgcttcagcctggtcaacctcccaacccttatgtccaacatcctcctttt
aaatttgttgtttttgttggcggtttccgtgctgaaaagcctgaattcgatcatttttat
aaccccaagcttaccactccttcgttacatattgctggtacttctgataccctggtccca
cttgctcgctccaaacagttggttgaacgttgcgaaaatgcacacgttttgttgcatccg
ggacaacatattgttcctcaacaagcagtgtataagactggcatccgtgatttcatgttt
tccgcccctaccaaggaacccactaagcaccctcgtgatcttacaatgattgtcgcggtt
tcttcgccaaacctcggtatcggaaagaagaactccatgccttggcatattaaacaagaa
atggcttactttgccaatgttacatcttctaccgaaagtagcggccaactggaagaagga
aaatccaagattatgaacgttgtaatcatgggtcgtagttgctacgacagtttgcccaag
aagaaccgtcctttgaaggatcgtatcaacattgttattacacgcaattctaactacaac
tttggtttgaccaaaaaagaaaagatgcccgagaatctgtatgcggctgattgtattgac
tcagcattggacctcgtggctgagaagtatggagctgatagcgacatccaagttggaaaa
gtgtttatcattggtggctctttcctttatggaagtgctctttaccatcctttgaccaaa
aaccttcttttcactcgtatccacaaagaatatccttgtgattctttctttccctttgaa
ccagctgaatcatctgactgggttagaaaggctcatcctgaattggaaaagtttgttggt
attccggtagaggaaggtcgtctgaaggcagcttcctcaaacaaagaagaggttgaaata
gaattcgagctttatggaaagaacgatgatgttaatgtagctttagaaaagcttagtatt
tgttag

DBGET integrated database retrieval system