KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1223.09Help
Entry
SPCC1223.09       CDS       T00076                                 

Definition
uricase (predicted) (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:spo00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(1857343..1858233)
Genome map
AA seq 296 aa AA seqDB search
MSETTYVKQCAYGKTLVRFMKKDICPKTKTHTVYEMDVQSLLTGELEESYTKADNSIVVP
TDTQKNTIYVFAKNNDVSVPEVFAAKLAKHFVDKYKHIHGAALDITITPWTRMEVQGKPH
SHSFIRNPGETRKTHVVFSEGKGFDVVSSLKDVLVLKSTGSGFTNFHKCEFTTLPEVTDR
IFSTSIDCNYTFKHFDTFEELAGFDFNSIYEKVKEITLETFALDDSESVQATMYKMADTI
INTYPAINEVYYALPNKHYFEINLAPFNIDNLGSNCSLYQPQAYPSGYITCTVARK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccacctatgttaagcaatgcgcctatggcaagaccttggttcgcttcatg
aagaaggatatctgccccaagaccaagactcacactgtctacgaaatggatgttcaaagt
ctcttgaccggtgaattagaagaatcttacaccaaggccgataactccatcgtcgttccc
accgacacccaaaagaataccatctatgtgtttgccaagaacaacgatgtcagtgttccc
gaggttttcgccgctaaacttgccaagcactttgtcgataaatacaagcacatccatgga
gctgccctcgatatcaccatcactccctggactcgcatggaggttcaaggaaagccccac
agccattccttcattcgcaaccccggtgagacacgcaagacccatgttgtcttttctgaa
ggcaagggattcgatgtcgttagctctttgaaggatgtcttggttctcaagagtactggc
agtggtttcaccaacttccacaagtgtgaatttaccactttacccgaggtcaccgatcgt
atcttttccacttccatcgactgcaactatactttcaagcactttgatactttcgaagag
cttgccggctttgactttaacagcatctacgaaaaggtcaaggaaatcacccttgagact
tttgctttggatgacagtgaaagtgttcaagctaccatgtataagatggccgacacaatc
atcaacacttatcccgccatcaacgaagtttactacgctcttcccaacaagcattacttc
gagatcaaccttgctcctttcaacatcgacaaccttggctctaactgctccttgtaccaa
ccacaagcctatccatctggttacattacttgtactgttgccagaaagtaa

DBGET integrated database retrieval system