KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1259.15cHelp
Entry
SPCC1259.15c      CDS       T00076                                 

Gene name
ubc11, ubcdp, ubcp4
Definition
(RefSeq) ubiquitin conjugating enzyme E2-C, Ubc11 (EC:6.3.2.19)
  KO
K06688  
ubiquitin-conjugating enzyme E2 C [EC:2.3.2.23]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPCC1259.15c (ubc11)
Enzymes [BR:spo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     SPCC1259.15c (ubc11)
Ubiquitin system [BR:spo04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   SPCC1259.15c (ubc11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(join(1058890..1058971,1059022..1059257,1059427..1059516,1059567..1059594,1059643..1059737))
Genome map
AA seq 176 aa AA seqDB search
MDSDMQNQNPHTNSKNSSSAGMAVDGHSVTKRLRSELMSLMMSNTPGISAFPDSDSNLLH
WAGTITGPSDTYYEGLKFKISMSFPANYPYSPPTIIFTSPMWHPNVDMSGNICLDILKDK
WSAVYNVQTILLSLQSLLGEPNNASPLNAQAAELWSKDPIEYKRLLMQRYKEIDEI
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggattctgatatgcaaaaccagaaccctcatactaattctaaaaactcttcttctgct
ggcatggctgttgacggtcatagcgttacaaaacgattgagaagcgaattaatgagttta
atgatgtccaatactcctggaattagtgcgtttccagattctgattctaacctgctacat
tgggctggcacaattaccggcccaagcgatacgtactatgaaggattgaaatttaaaatt
tcaatgtcatttccagctaattacccatattcccctccaactatcatttttacttcacca
atgtggcaccccaatgtcgatatgagtggaaacatatgtttagacattttaaaagataaa
tggtcagcagtctataacgtacagacaattttgttatctctacaaagtctgctgggtgag
ccaaacaatgcttctcccttgaatgctcaagctgcagaattgtggagtaaagaccctatc
gagtacaaacgtcttttaatgcagagatataaagaaatcgatgaaatttag

DBGET integrated database retrieval system