KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1281.06cHelp
Entry
SPCC1281.06c      CDS       T00076                                 

Definition
acyl-coA desaturase (predicted)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:spo01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:spo01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(1392690..1394129)
Genome map
AA seq 479 aa AA seqDB search
MTAPSATAFSSATTQPTTEGNASMRKRTIPVVPSVPERKWDPKAPKHIQEQPWTMQNWWR
HLNWLHCMLIFGLPMIAIYGVFTTPLQTKTLIFAIIYYAYSGLGITAGYHRLWSHRAYKA
KKPLEYFLAAGGAAAFEGSIRWWSRDHRAHHRYTDTDKDPYNVKKGFWYAHVGWMIILQN
PRRIGRSDVSDLNSDPFVMFNHRHFLPIASFMAFIFPSLFCGLLWGDYRGGYFYAGVCRL
VFVHHATFCVNSLAHLIGSQPFDDTNSARNHFITALVTLGEGNHNYHHAFPNDYRNGLRW
YEYDPTKIFIYIASLFGLAYNLNTFPDNEIQKGIVQQKQKVLDRWRAKLNWGIPLEQLPV
MEFEDFLEQSKTRPLVLINGVVHDMTGFEHPGGQGLLRSAFGKDATAAFNGGVYDHTNGA
HNLLSTYRVAVVRGGMEVEVWKSGAGAQLPMKDTQGQKIVRVGEQITRIQPPIEAAAAN
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgactgctccttctgcaactgctttctcctccgctaccactcagcccaccactgagggt
aacgcttctatgcgcaagcgtactattcctgtcgtccccagcgttcccgaacgcaaatgg
gatcccaaggcccccaagcatatccaagaacaaccttggaccatgcaaaactggtggaga
catttgaattggcttcattgtatgcttatctttggtcttcccatgatcgccatctatggt
gtctttaccactcccttacaaaccaagactttgattttcgccattatatactacgcctac
tctggtttgggtatcactgccggttaccatcgtctctggtctcatcgtgcttacaaggct
aagaagcctttggaatactttttggctgccggtggtgctgctgcctttgagggctccatt
cgttggtggtctcgtgaccatcgtgctcaccaccgttacaccgataccgacaaggatccc
tacaacgtcaagaagggtttctggtatgctcatgtcggttggatgatcatcttgcaaaac
ccccgtcgtattggtcgctccgatgtctccgatttgaactcggatccctttgtcatgttc
aaccaccgtcacttcttgcccattgctagcttcatggccttcatcttcccttctctcttc
tgcggtttgttgtggggtgattaccgtggtggttatttctatgccggtgtctgccgtttg
gtctttgttcaccacgctaccttctgtgttaactctcttgctcacttgatcggtagccaa
ccctttgacgacaccaacagtgcccgtaaccacttcatcaccgccttggtcactcttggt
gagggcaaccacaactaccaccatgctttccccaacgattaccgtaacggtcttagatgg
tacgaatatgatcccaccaagatcttcatctacattgccagtctctttggtcttgcctac
aacctcaacactttccctgacaacgaaatccaaaagggtattgttcaacaaaagcaaaag
gttttggaccgctggcgtgccaagcttaactggggtattcctcttgaacaacttcccgtc
atggaattcgaagactttttggagcaaagcaagactcgtcccttggttctcatcaatggt
gttgttcacgacatgaccggtttcgagcacccaggtggtcaaggccttttgcgttctgct
ttcggtaaggatgccactgctgctttcaacggtggtgtttatgaccacactaatggtgcc
cacaacttgctttccacttatcgtgtcgccgttgttcgcggtggtatggaggttgaggtg
tggaagtctggtgccggtgcccaactccctatgaaggatacccaaggacaaaagattgtt
cgcgttggtgagcaaattactcgtattcagcctcccatcgaggctgctgccgctaactaa

DBGET integrated database retrieval system