KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1281.06cHelp
Entry
SPCC1281.06c      CDS       T00076                                 

Definition
(RefSeq) acyl-coA desaturase (predicted)
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo01040  Biosynthesis of unsaturated fatty acids
spo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SPCC1281.06c
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     SPCC1281.06c
Lipid biosynthesis proteins [BR:spo01004]
 Desaturase
  First
   SPCC1281.06c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase Cyt-b5
Motif
Other DBs
NCBI-GeneID: 2538753
NCBI-ProteinID: NP_588170
PomBase: SPCC1281.06c
UniProt: O94523
Position
III:complement(1392690..1394129)
Genome map
AA seq 479 aa AA seqDB search
MTAPSATAFSSATTQPTTEGNASMRKRTIPVVPSVPERKWDPKAPKHIQEQPWTMQNWWR
HLNWLHCMLIFGLPMIAIYGVFTTPLQTKTLIFAIIYYAYSGLGITAGYHRLWSHRAYKA
KKPLEYFLAAGGAAAFEGSIRWWSRDHRAHHRYTDTDKDPYNVKKGFWYAHVGWMIILQN
PRRIGRSDVSDLNSDPFVMFNHRHFLPIASFMAFIFPSLFCGLLWGDYRGGYFYAGVCRL
VFVHHATFCVNSLAHLIGSQPFDDTNSARNHFITALVTLGEGNHNYHHAFPNDYRNGLRW
YEYDPTKIFIYIASLFGLAYNLNTFPDNEIQKGIVQQKQKVLDRWRAKLNWGIPLEQLPV
MEFEDFLEQSKTRPLVLINGVVHDMTGFEHPGGQGLLRSAFGKDATAAFNGGVYDHTNGA
HNLLSTYRVAVVRGGMEVEVWKSGAGAQLPMKDTQGQKIVRVGEQITRIQPPIEAAAAN
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgactgctccttctgcaactgctttctcctccgctaccactcagcccaccactgagggt
aacgcttctatgcgcaagcgtactattcctgtcgtccccagcgttcccgaacgcaaatgg
gatcccaaggcccccaagcatatccaagaacaaccttggaccatgcaaaactggtggaga
catttgaattggcttcattgtatgcttatctttggtcttcccatgatcgccatctatggt
gtctttaccactcccttacaaaccaagactttgattttcgccattatatactacgcctac
tctggtttgggtatcactgccggttaccatcgtctctggtctcatcgtgcttacaaggct
aagaagcctttggaatactttttggctgccggtggtgctgctgcctttgagggctccatt
cgttggtggtctcgtgaccatcgtgctcaccaccgttacaccgataccgacaaggatccc
tacaacgtcaagaagggtttctggtatgctcatgtcggttggatgatcatcttgcaaaac
ccccgtcgtattggtcgctccgatgtctccgatttgaactcggatccctttgtcatgttc
aaccaccgtcacttcttgcccattgctagcttcatggccttcatcttcccttctctcttc
tgcggtttgttgtggggtgattaccgtggtggttatttctatgccggtgtctgccgtttg
gtctttgttcaccacgctaccttctgtgttaactctcttgctcacttgatcggtagccaa
ccctttgacgacaccaacagtgcccgtaaccacttcatcaccgccttggtcactcttggt
gagggcaaccacaactaccaccatgctttccccaacgattaccgtaacggtcttagatgg
tacgaatatgatcccaccaagatcttcatctacattgccagtctctttggtcttgcctac
aacctcaacactttccctgacaacgaaatccaaaagggtattgttcaacaaaagcaaaag
gttttggaccgctggcgtgccaagcttaactggggtattcctcttgaacaacttcccgtc
atggaattcgaagactttttggagcaaagcaagactcgtcccttggttctcatcaatggt
gttgttcacgacatgaccggtttcgagcacccaggtggtcaaggccttttgcgttctgct
ttcggtaaggatgccactgctgctttcaacggtggtgtttatgaccacactaatggtgcc
cacaacttgctttccacttatcgtgtcgccgttgttcgcggtggtatggaggttgaggtg
tggaagtctggtgccggtgcccaactccctatgaaggatacccaaggacaaaagattgtt
cgcgttggtgagcaaattactcgtattcagcctcccatcgaggctgctgccgctaactaa

DBGET integrated database retrieval system