KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1322.04Help
Entry
SPCC1322.04       CDS       T00076                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (predicted) (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPCC1322.04
   00052 Galactose metabolism
    SPCC1322.04
   00500 Starch and sucrose metabolism
    SPCC1322.04
   00520 Amino sugar and nucleotide sugar metabolism
    SPCC1322.04
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SPCC1322.04
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:1292178..1293698
Genome map
AA seq 506 aa AA seqDB search
MDLAPRPLGRQHSKSQSAFAFDNTATSIAASTMKNELNHLASTVKDPLAKKAFQKEMDNF
FSLFSRYLQEDARGSEINWDLVESPKPEQVVEYDTITEAGGLSRDYLNKLAVLKLNGGLG
TTMGCVGPKSIIEVRDGNSFLDLSVRQIEHLNRKYNVNVPFVLMNSFNTDEATAKVIKKY
EAHKIDILTFNQSRYPRVHKETLLPVPHTADSAIDEWYPPGHGDVFEALTNSGIIDTLIA
QGKEYLFVSNIDNLGAVVDLNILNHMVETNAEYLMELTNKTKADVKGGTLIDYDGNVRLL
EIAQVPPQHVEEFKSIKKFKYFNTNNLWFHLPSVKRVVNNHELSMEIIPNKKTIKHKGEN
INIIQLETAAGAAIRHFKNAHGVNVPRRRFLPVKTCSDLLLVKSDLYSINHGQVEMNPRR
FGGTAPLVKLGAHFKKVADFSAHIPSIPKILELDHLTITGDVNIGRNVTLKGTVIIVASD
ANRIDIPNGSVLENCVITGNLNILEH
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggatttggcaccacgtcccctcggtcgtcagcacagcaagtcgcaatcggcttttgct
tttgacaacaccgctaccagtattgctgccagtactatgaagaatgagctgaatcacttg
gctagcaccgtaaaggatcccttggctaagaaggcctttcaaaaggagatggacaacttt
ttcagcttgttcagtcgctatcttcaggaggacgctcgtggctcggaaatcaactgggac
cttgtagagtctcccaagcccgagcaagtcgtcgaatacgataccattaccgaggcgggc
ggcctgtctcgtgactaccttaacaagcttgccgtcctcaagcttaatggtggattgggc
actacgatgggttgcgttggacccaaatccatcattgaagttcgtgatggtaacagtttt
ctggatttgagcgttcgtcaaatcgagcatttgaatcgtaaatacaatgttaacgttcct
ttcgttttaatgaactctttcaacaccgatgaggccaccgccaaggtcatcaagaagtac
gaggcccataagatcgacattctcacctttaatcaatcccgttatcctcgtgttcataag
gagactttactacccgttcctcacactgccgactcggctattgacgagtggtatcctcct
ggtcatggtgatgtgtttgaggccctcactaacagcggcatcatcgacacccttattgct
cagggtaaggagtatttgtttgtcagcaacattgacaacttgggtgccgttgtcgacttg
aacatcttgaaccatatggttgagaccaatgccgaatatcttatggagttgaccaacaag
accaaggccgatgttaagggtggtactttgattgattatgatggtaacgttcgtcttctt
gagattgctcaagttcctcctcaacacgtggaggaatttaagtctatcaagaagttcaag
tacttcaacaccaataacctttggttccatcttccctctgttaagcgtgttgtcaacaat
cacgagctcagcatggagatcatccccaacaagaagaccatcaaacacaaaggtgagaat
atcaatatcattcaattggaaactgccgctggtgccgctatccgtcattttaagaacgcc
cacggtgttaacgtccctagaagacgtttcttacccgtcaaaacctgctctgacttactt
ctcgtcaagtctgacctctattccatcaaccatggtcaggttgagatgaatcctcgccga
ttcggaggtaccgctcctttagtcaaattaggcgcacacttcaagaaagttgctgatttc
tctgctcacattcccagcattccaaaaatccttgaacttgatcatctgaccattactggt
gacgttaatattggtcgcaatgttactcttaagggtaccgtgattattgtcgctagtgat
gccaaccgtattgacattcctaatggttctgtccttgagaactgtgtcattaccggtaat
ctcaatatcttggagcactaa

DBGET integrated database retrieval system