KEGG   Schizosaccharomyces pombe (fission yeast): SPCC13B11.01Help
Entry
SPCC13B11.01      CDS       T00076                                 

Gene name
adh1, adh
Definition
alcohol dehydrogenase Adh1 (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SPCC13B11.01 (adh1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPCC13B11.01 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    SPCC13B11.01 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPCC13B11.01 (adh1)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPCC13B11.01 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:1591359..1592411
Genome map
AA seq 350 aa AA seqDB search
MTIPDKQLAAVFHTHGGPENVKFEEVPVAEPGQDEVLVNIKYTGVCHTDLHALQGDWPLP
AKMPLIGGHEGAGVVVKVGAGVTRLKIGDRVGVKWMNSSCGNCEYCMKAEETICPHIQLS
GYTVDGTFQHYCIANATHATIIPESVPLEVAAPIMCAGITCYRALKESKVGPGEWICIPG
AGGGLGHLAVQYAKAMAMRVVAIDTGDDKAELVKSFGAEVFLDFKKEADMIEAVKAATNG
GAHGTLVLSTSPKSYEQAAGFARPGSTMVTVSMPAGAKLGADIFWLTVKMLKICGSHVGN
RIDSIEALEYVSRGLVKPYYKVQPFSTLPDVYRLMHENKIAGRIVLDLSK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgactattcctgacaagcagttggctgccgttttccacacccacggtggtcccgagaac
gtcaagttcgaggaagtccccgtcgccgagcccggtcaagacgaggtcttggttaacatc
aagtacaccggtgtctgccacaccgatttacacgctcttcaaggtgactggcctcttccc
gccaagatgcctttgatcggtggtcacgaaggtgctggtgtcgtcgtcaaggtcggtgcc
ggtgtcactcgtcttaagattggtgaccgtgttggtgtcaagtggatgaactcttcttgc
ggtaactgcgagtactgtatgaaggctgaggagaccatctgccctcacattcaactttcc
ggttacaccgttgacggtactttccaacactactgcattgccaatgccacccatgctacc
atcatccccgagtccgttcccctcgaggttgctgctcccatcatgtgcgctggtatcact
tgctatcgtgccttgaaggaatccaaggtcggccctggtgagtggatctgcattcccggt
gccggtggtggtcttggccatcttgccgtccaatacgccaaggctatggctatgcgtgtt
gttgccattgatactggtgatgacaaggctgagctcgtcaagtcctttggtgctgaggtc
ttccttgacttcaagaaggaagccgacatgattgaggctgtcaaggctgccaccaacggt
ggtgcccacggtaccttggtcttatccacctcccccaagtcttacgagcaagctgctggc
tttgcccgtcccggttccaccatggtcactgtttccatgcctgccggtgccaagctcggt
gctgatatcttctggttgaccgttaagatgcttaagatctgcggttctcacgtcggtaac
cgtattgactctatcgaggctcttgaatacgtttcccgtggtctcgtcaagccttactac
aaggtccaacccttctctactcttcccgacgtctaccgtctcatgcatgagaacaagatt
gccggccgtatcgtcttggacctttccaagtaa

DBGET integrated database retrieval system