KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1450.07cHelp
Entry
SPCC1450.07c      CDS       T00076                                 

Definition
D-amino acid oxidase (predicted) (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:spo00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:spo00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:spo00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:spo04146]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(1736606..1737652)
Genome map
AA seq 348 aa AA seqDB search
MTKENKPRDIVIVGAGVIGLTTAWILSDLGLAPRIKVIAKYTPEDRSVEYTSPWAGANFC
SISATDDNALRWDKITYHRFAYLAKTRPEAGIRFADLRELWEYEPKHDKIRSWNTYVRDF
KVIPEKDLPGECIYGHKATTFLINAPHYLNYMYKLLIEAGVEFEKKELSHIKETVEETPE
ASVVFNCTGLWASKLGGVEDPDVYPTRGHVVLVKAPHVTETRILNGKNSDTYIIPRPLNG
GVICGGFMQPGNWDREIHPEDTLDILKRTSALMPELFHGKGPEGAEIIQECVGFRPSRKG
GARVELDVVPGTSVPLVHDYGASGTGYQAGYGMALDSVMLALPKIKLA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggaaaataagccaagagatattgtcatcgttggcgctggcgttattggattg
accactgcttggattctttcagacttgggtcttgctcctcgtattaaggtgattgccaag
tatacgcctgaagatcgttctgtagaatacacttccccttgggctggcgcaaatttctgt
agcatttctgctactgatgacaatgctttgcgctgggataaaatcacttaccatcgtttc
gcctacttggcgaaaactcgtcctgaagcaggaatccgttttgctgatcttcgagaattg
tgggagtacgagccgaaacacgacaaaatcagatcctggaatacctatgtcagagatttc
aaagttatccctgaaaaagatcttccaggagaatgtatctacggacataaggccaccacc
tttttaatcaacgctcctcattacttgaattatatgtacaagctgctcattgaagctggc
gtcgaatttgaaaagaaagaattgagtcacatcaaagagactgtcgaagaaactccagaa
gcttcagtagtatttaattgcactggtctctgggcttccaaattgggtggcgttgaagac
ccggacgtttatccgactcgtggacatgttgttttggttaaggctcctcatgtaacagaa
actcgcattttgaatggcaagaactctgatacctatattattcctcgtcccttaaatggt
ggagtcatttgcggcggtttcatgcaaccaggaaactgggatcgtgaaattcaccctgaa
gacactttggatatccttaagagaacatcggctttgatgccagaattgttccacggcaag
ggtccggagggtgctgaaattattcaagaatgtgtcggattccgtccttctcgaaagggt
ggtgcccgcgtagagcttgatgttgttcccggcacctcagtcccccttgttcatgattac
ggtgcttctggcacaggataccaagctggttatggtatggctcttgactctgtcatgttg
gctcttcctaaaatcaaattggcttag

DBGET integrated database retrieval system