KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1450.07cHelp
Entry
SPCC1450.07c      CDS       T00076                                 

Definition
D-amino acid oxidase (predicted) (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPCC1450.07c
   00330 Arginine and proline metabolism
    SPCC1450.07c
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    SPCC1450.07c
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    SPCC1450.07c
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    SPCC1450.07c
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     SPCC1450.07c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(1736606..1737652)
Genome map
AA seq 348 aa AA seqDB search
MTKENKPRDIVIVGAGVIGLTTAWILSDLGLAPRIKVIAKYTPEDRSVEYTSPWAGANFC
SISATDDNALRWDKITYHRFAYLAKTRPEAGIRFADLRELWEYEPKHDKIRSWNTYVRDF
KVIPEKDLPGECIYGHKATTFLINAPHYLNYMYKLLIEAGVEFEKKELSHIKETVEETPE
ASVVFNCTGLWASKLGGVEDPDVYPTRGHVVLVKAPHVTETRILNGKNSDTYIIPRPLNG
GVICGGFMQPGNWDREIHPEDTLDILKRTSALMPELFHGKGPEGAEIIQECVGFRPSRKG
GARVELDVVPGTSVPLVHDYGASGTGYQAGYGMALDSVMLALPKIKLA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggaaaataagccaagagatattgtcatcgttggcgctggcgttattggattg
accactgcttggattctttcagacttgggtcttgctcctcgtattaaggtgattgccaag
tatacgcctgaagatcgttctgtagaatacacttccccttgggctggcgcaaatttctgt
agcatttctgctactgatgacaatgctttgcgctgggataaaatcacttaccatcgtttc
gcctacttggcgaaaactcgtcctgaagcaggaatccgttttgctgatcttcgagaattg
tgggagtacgagccgaaacacgacaaaatcagatcctggaatacctatgtcagagatttc
aaagttatccctgaaaaagatcttccaggagaatgtatctacggacataaggccaccacc
tttttaatcaacgctcctcattacttgaattatatgtacaagctgctcattgaagctggc
gtcgaatttgaaaagaaagaattgagtcacatcaaagagactgtcgaagaaactccagaa
gcttcagtagtatttaattgcactggtctctgggcttccaaattgggtggcgttgaagac
ccggacgtttatccgactcgtggacatgttgttttggttaaggctcctcatgtaacagaa
actcgcattttgaatggcaagaactctgatacctatattattcctcgtcccttaaatggt
ggagtcatttgcggcggtttcatgcaaccaggaaactgggatcgtgaaattcaccctgaa
gacactttggatatccttaagagaacatcggctttgatgccagaattgttccacggcaag
ggtccggagggtgctgaaattattcaagaatgtgtcggattccgtccttctcgaaagggt
ggtgcccgcgtagagcttgatgttgttcccggcacctcagtcccccttgttcatgattac
ggtgcttctggcacaggataccaagctggttatggtatggctcttgactctgtcatgttg
gctcttcctaaaatcaaattggcttag

DBGET integrated database retrieval system