KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1450.09cHelp
Entry
SPCC1450.09c      CDS       T00076                                 

Definition
phospholipase (predicted) (EC:3.1.1.5)
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:spo00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(1741588..1743459)
Genome map
AA seq 623 aa AA seqDB search
MKLSSFGLFLALQLLPALGLPSRIDEVDVSDPELIGLLKPDNVDKPANSIPLSKRSTSPS
YAPYTVACPSGSLLRPASDGLSTGEQEFVDKRVSKVNSALESFISKTGLKIDTKSVLNDT
DGPRLGIAISGGGFPAMLTGAGAINAFDARNGNTTSLGGILQSSMYLTGLSGGSWLVGSV
AVNNFANITFLHDDVWNLDHSLFAPYDDAFENFYIYQEWFEQVLQKKNAGFNVSITDLWG
RALALKLVNPLTGGANTTFSSVTNETWFQDGEFPFPIIIADNVIEGETVIPLNDTVFEFT
PIEFGTWDTGVESFIPMEYTGTHLINGIPLNESCVRNFDNAGFLMGTSSNVFSGILPATN
ASLTASNNTFNNAVLSFLEMLAEDQLDVGLYPNPYQGYGNASNTTTTNPLEPYPIIELID
GGSDSEGIPFWPLLHPQRDVDVIFAIDGGYQSATSGWPDGSSLVSTYERVLATNSSGVRG
FPYIPDTNTFLALGLNTHPTFFGCDGRNTTAGNHTVNDDTPPLVVYFPNYPWTMYANVTT
YTVQLEDTLSSGMIENAAVAATQNNSDSFAVCVACALVQRSLERKNMSTPSQCASCFNQY
CWNGTIASTTVTTYAPTVLSAKI
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatcttcctttggattatttctcgctctccagcttttgccggccttgggcctt
ccttctcgtatcgatgaagtagacgtttcagacccagaactaatcggattattgaaaccc
gataacgttgataagccagcaaactctatacccctttccaagcgtagcacaagcccatcg
tatgcgccttatactgttgcttgccctagtggctctctgcttcgacctgcctccgatggc
cttagtactggtgaacaagaatttgttgacaaacgtgtctcaaaggttaacagtgcattg
gaaagctttatttcaaaaaccggcttaaaaatcgatacaaaaagtgtgctgaatgacaca
gatggccctcgtttgggaattgcaatctctggcggtggatttcctgccatgttaacggga
gccggcgctattaatgcatttgatgctagaaatggtaacactacgtctcttggtggtatt
cttcaatcttccatgtaccttactggtctttctggtggctcttggcttgtgggatctgtt
gcggttaacaactttgccaatattactttcttgcacgacgacgtttggaacctggaccac
agtctcttcgctccctatgacgacgcttttgagaacttttatatttaccaagagtggttt
gagcaagttctgcaaaagaagaatgctggattcaatgtctccattactgacctttggggc
cgtgctttggctcttaagcttgtcaatcctttgactggaggtgctaatactacattctct
agtgtaacaaatgaaacgtggttccaggatggtgaatttccctttcccatcatcattgct
gataatgtcatagagggtgaaaccgtaatccctttgaacgacactgtctttgaatttaca
cccatcgaatttggtacttgggacactggggtggaatcatttatacccatggagtataca
ggtacacaccttattaatggcattcctcttaatgaatcctgtgtgcgtaatttcgacaac
gctggtttcctcatgggtacctcttcaaatgtttttagcggtatccttcctgcgacaaat
gcatcactcaccgctagtaataatacctttaacaatgctgtccttagtttcctcgaaatg
cttgccgaagatcaattggatgtaggtctttatcccaacccttaccaaggttatggaaat
gcttccaatacaaccactaccaatcccttggagccgtatcccattattgaattaatagac
ggtggctcagatagtgaaggtattcccttttggcccttgcttcatccacaaagagacgta
gatgttatttttgcgattgacgggggttatcaaagcgcaacgagtggatggccagatgga
tcgtccctagtttctacatatgaaagagttttagccactaactcctctggcgttcgtggt
ttcccatatattcctgataccaacacatttttggctcttggtttgaacactcatccaact
ttcttcggttgcgacggtagaaacaccacagccggaaaccataccgttaatgacgatact
cctcctcttgtagtttacttccccaactatccttggactatgtatgcaaatgtcactacc
tacactgttcaactggaagatactttgtccagtggaatgattgaaaatgccgctgttgct
gctacccaaaataacagtgattcatttgctgtctgcgttgcatgcgctctcgttcaacgt
tccttggaacgcaaaaacatgtcgactccaagtcaatgtgcttcttgctttaatcaatac
tgttggaatggaacaattgcaagcacgaccgttactacatatgcacctacagttctgtca
gccaagatttag

DBGET integrated database retrieval system