KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1494.05cHelp
Entry
SPCC1494.05c      CDS       T00076                                 

Gene name
ubp12
Definition
(RefSeq) CSN-associated deubiquitinating enzyme Ubp12
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SPCC1494.05c (ubp12)
Peptidases [BR:spo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SPCC1494.05c (ubp12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(2329468..2332407)
Genome map
AA seq 979 aa AA seqDB search
MDSLSESSTSSYHGKRPRSLSEESQSSSNMDDISQKSISLGDASEISKNLPSIAEQKQLI
GELVNNQPELELGQVDNYILSYSWYERLCSYLAEDGPFPGPVDQEDIADLETGTLKPDLQ
EEIDFTIISRDVWDLLVRWYGLKGPEFPRETVNLGSESHPHLVVEVYPPIFSLTLLSTNA
VDANESHKPKKISLSSKSTLEDLLEGVKYTLSLPSDQFRLWRVDTDQPLHRTIDPSSFIK
INSKEIIDFLEKSKTLVELGMDSSCSLVAECMINETWPVDRALRLQFLIQQRNNQSSNEE
QKQEKRVPGTCGLSNLGNTCYMNSALQCLTHTRELRDFFTSDEWKNQVNESNPLGMGGQV
ASIFASLIKSLYSPEHSSFAPRQFKATIGKFNHSFLGYGQQDSQEFLAFLLDGLHEDLNR
IYQKPYTSKPDLYEVDEEKIKNTAEECWRLHKLRNDSLIVDLFQGMYRSTLVCPVCNTVS
ITFDPFMDLTLPLPVKQVWSHTVTFIPADTNLTPLAIEVVLESKAATIEDLVKYVAEKSG
CSDYRKILVTETYKGRFYRFLTQLSKSLLMEISEEDEIYLYELERPYEDGSDDILVPVYH
ISDDSTNSANSYMSSRDFGHPFVLQLSDNEVTDASFISEKLKLKYQQFTTLKNLKNIDSL
ESLELGHEDEQVQKGPLDVDMDHSQTPLFEMRVFHDRFEKIPTGWNMSVSNLPLLTERDK
KDLESTVDPLDAHSIEEEDDSEFKDVAPGSYPEPSKSNENTKLTAKENDRLLIQGDLLVC
EWPEKSYQFVFSVAPSSPQMGRSLWLESKTILSDKKDDSEDSRTITLNDCLDEFEKTEQL
GEEDPWYCPTCKEFRQASKQMEIWRCPEILIFHLKRFSSERRFRDKIDDLVEFPIDNLDM
SMRTGSYKLSEKENPKLIYELYAVDNHYGGLGGGHYTAFAKNPDNGQFYCFDDSRVTPVC
PEETVTSAAYLLFYRRKTS
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atggattctctgtcggaaagttctacttcttcatatcacggaaaaagaccgcggtccttg
agcgaggaatcgcaaagctcttccaacatggatgatatttcacaaaaatcaatatctttg
ggtgatgcttcagaaatatcaaagaaccttccttctattgcagaacaaaagcagttaata
ggcgagttggtaaacaatcaacccgaacttgagttgggacaggttgacaattacattctt
tcgtatagttggtatgaacgactctgctcgtatttggcagaggatggtccctttcctgga
ccggtagatcaagaagatattgctgatttagaaactggaacgttgaagccggatttgcaa
gaagagattgattttaccatcatttctcgagatgtatgggatttattggttcgctggtat
ggactaaaaggacccgaatttccaagggaaactgtaaacctgggctcagagtcgcatcct
catttggtagttgaagtttacccaccaatcttttcattaacactgttgagcaccaatgct
gtggacgcgaatgagtctcataagcctaaaaaaatatctctttcctcaaaaagtacttta
gaggatctattggaaggggttaaatataccctttctctccccagtgatcagtttaggtta
tggagagttgacacggatcagcctttgcatagaactatcgatccctcatcttttataaaa
atcaattcgaaagaaattatcgattttttagaaaaatccaagactttggtagaactggga
atggacagtagctgttcattagtggctgaatgcatgataaatgaaacatggccagtagac
cgtgcgcttcgcctacaattcttaattcagcagagaaataatcaatcatctaatgaagaa
caaaaacaagaaaaaagggttccaggaacctgtggtcttagcaaccttggaaatacttgt
tatatgaattccgcactccaatgtttaacccacactcgtgaactgcgtgacttttttaca
tcagatgagtggaaaaatcaagtaaatgagtcaaatccccttggtatgggtggccaagtt
gccagtatatttgcatctcttataaaatctttatattctccagaacattcctctttcgct
ccaaggcaatttaaagcaactattggtaaattcaatcattcttttttgggatatggccaa
caggattctcaagagtttttagcttttcttctagatggactacatgaagatttgaacaga
atctatcaaaagccgtatacctctaaacccgacttgtatgaagtggacgaagagaaaata
aaaaatactgctgaggagtgctggagattacataaactaaggaatgactctcttattgta
gatttatttcaaggcatgtatcgtagtacccttgtgtgccctgtttgtaacaccgtctcg
attacctttgatcctttcatggatcttacccttccattacctgtcaagcaagtatggtcg
catactgttacctttattccagctgatacaaatcttactccattagctattgaggtagta
ctcgagagtaaggcggcgacgattgaagaccttgtcaaatatgtcgcagaaaaatctgga
tgtagcgattacaggaaaatattggttactgaaacttataagggaaggttctataggttc
cttacacaactttccaaatctttgttaatggagatttctgaggaagatgaaatttatctt
tatgagttagagagaccgtacgaagatggatctgatgacattttggttcctgtctatcat
atatctgatgattctacaaattcggcaaactcctatatgagttcacgcgattttggtcac
ccatttgtcctgcaattgtcagacaatgaagttactgatgcttcctttataagtgaaaag
ctcaaacttaaatatcagcaatttacaactttaaaaaacttaaaaaatattgactcgttg
gagtctttggaacttggccacgaagatgaacaagtgcaaaaaggtccgttggatgttgat
atggatcatagtcagacaccattgtttgaaatgagagttttccatgatcggtttgaaaaa
atccctaccggttggaacatgagtgtttctaacttgcctttgttaaccgaacgggataaa
aaggatttagaatcgacggtcgatcctttagatgctcattcaattgaggaagaagatgac
agtgagttcaaagacgttgcacccggttcatatcctgagccttcgaagagtaacgaaaac
accaagttgaccgcaaaggaaaatgatcgtttgcttattcagggtgacttgctggtgtgt
gagtggcctgaaaaatcctatcaatttgtatttagtgtggcaccttcttctcctcaaatg
ggacgttcattgtggctagaatcaaaaacaatattgtcggacaaaaaggatgattctgaa
gattctcgtaccattactttgaatgattgtttagatgagttcgaaaaaacggagcaactg
ggtgaagaagatccttggtactgtcctacatgcaaagaatttcgacaggctagtaaacaa
atggaaatttggagatgccccgaaattttgattttccatttgaagagatttagcagtgaa
agaaggtttagggataaaattgacgacttagttgaattccctattgacaatttagatatg
tctatgcggacgggtagctataaattgtccgaaaaagaaaatcctaaattaatttatgag
ctttatgctgtcgataatcactatggcggtcttggaggcggtcattacacagcatttgct
aaaaatcccgacaatggacaattttattgttttgatgattcacgggtcactcctgtatgt
cctgaagaaactgtcacctcagctgcatatctgttgttttatcgccgaaaaacaagctaa

DBGET integrated database retrieval system