KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1494.05cHelp
Entry
SPCC1494.05c      CDS       T00076                                 

Gene name
ubp12
Definition
CSN-associated deubiquitinating enzyme Ubp12
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(2329468..2332407)
Genome map
AA seq 979 aa AA seqDB search
MDSLSESSTSSYHGKRPRSLSEESQSSSNMDDISQKSISLGDASEISKNLPSIAEQKQLI
GELVNNQPELELGQVDNYILSYSWYERLCSYLAEDGPFPGPVDQEDIADLETGTLKPDLQ
EEIDFTIISRDVWDLLVRWYGLKGPEFPRETVNLGSESHPHLVVEVYPPIFSLTLLSTNA
VDANESHKPKKISLSSKSTLEDLLEGVKYTLSLPSDQFRLWRVDTDQPLHRTIDPSSFIK
INSKEIIDFLEKSKTLVELGMDSSCSLVAECMINETWPVDRALRLQFLIQQRNNQSSNEE
QKQEKRVPGTCGLSNLGNTCYMNSALQCLTHTRELRDFFTSDEWKNQVNESNPLGMGGQV
ASIFASLIKSLYSPEHSSFAPRQFKATIGKFNHSFLGYGQQDSQEFLAFLLDGLHEDLNR
IYQKPYTSKPDLYEVDEEKIKNTAEECWRLHKLRNDSLIVDLFQGMYRSTLVCPVCNTVS
ITFDPFMDLTLPLPVKQVWSHTVTFIPADTNLTPLAIEVVLESKAATIEDLVKYVAEKSG
CSDYRKILVTETYKGRFYRFLTQLSKSLLMEISEEDEIYLYELERPYEDGSDDILVPVYH
ISDDSTNSANSYMSSRDFGHPFVLQLSDNEVTDASFISEKLKLKYQQFTTLKNLKNIDSL
ESLELGHEDEQVQKGPLDVDMDHSQTPLFEMRVFHDRFEKIPTGWNMSVSNLPLLTERDK
KDLESTVDPLDAHSIEEEDDSEFKDVAPGSYPEPSKSNENTKLTAKENDRLLIQGDLLVC
EWPEKSYQFVFSVAPSSPQMGRSLWLESKTILSDKKDDSEDSRTITLNDCLDEFEKTEQL
GEEDPWYCPTCKEFRQASKQMEIWRCPEILIFHLKRFSSERRFRDKIDDLVEFPIDNLDM
SMRTGSYKLSEKENPKLIYELYAVDNHYGGLGGGHYTAFAKNPDNGQFYCFDDSRVTPVC
PEETVTSAAYLLFYRRKTS
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atggattctctgtcggaaagttctacttcttcatatcacggaaaaagaccgcggtccttg
agcgaggaatcgcaaagctcttccaacatggatgatatttcacaaaaatcaatatctttg
ggtgatgcttcagaaatatcaaagaaccttccttctattgcagaacaaaagcagttaata
ggcgagttggtaaacaatcaacccgaacttgagttgggacaggttgacaattacattctt
tcgtatagttggtatgaacgactctgctcgtatttggcagaggatggtccctttcctgga
ccggtagatcaagaagatattgctgatttagaaactggaacgttgaagccggatttgcaa
gaagagattgattttaccatcatttctcgagatgtatgggatttattggttcgctggtat
ggactaaaaggacccgaatttccaagggaaactgtaaacctgggctcagagtcgcatcct
catttggtagttgaagtttacccaccaatcttttcattaacactgttgagcaccaatgct
gtggacgcgaatgagtctcataagcctaaaaaaatatctctttcctcaaaaagtacttta
gaggatctattggaaggggttaaatataccctttctctccccagtgatcagtttaggtta
tggagagttgacacggatcagcctttgcatagaactatcgatccctcatcttttataaaa
atcaattcgaaagaaattatcgattttttagaaaaatccaagactttggtagaactggga
atggacagtagctgttcattagtggctgaatgcatgataaatgaaacatggccagtagac
cgtgcgcttcgcctacaattcttaattcagcagagaaataatcaatcatctaatgaagaa
caaaaacaagaaaaaagggttccaggaacctgtggtcttagcaaccttggaaatacttgt
tatatgaattccgcactccaatgtttaacccacactcgtgaactgcgtgacttttttaca
tcagatgagtggaaaaatcaagtaaatgagtcaaatccccttggtatgggtggccaagtt
gccagtatatttgcatctcttataaaatctttatattctccagaacattcctctttcgct
ccaaggcaatttaaagcaactattggtaaattcaatcattcttttttgggatatggccaa
caggattctcaagagtttttagcttttcttctagatggactacatgaagatttgaacaga
atctatcaaaagccgtatacctctaaacccgacttgtatgaagtggacgaagagaaaata
aaaaatactgctgaggagtgctggagattacataaactaaggaatgactctcttattgta
gatttatttcaaggcatgtatcgtagtacccttgtgtgccctgtttgtaacaccgtctcg
attacctttgatcctttcatggatcttacccttccattacctgtcaagcaagtatggtcg
catactgttacctttattccagctgatacaaatcttactccattagctattgaggtagta
ctcgagagtaaggcggcgacgattgaagaccttgtcaaatatgtcgcagaaaaatctgga
tgtagcgattacaggaaaatattggttactgaaacttataagggaaggttctataggttc
cttacacaactttccaaatctttgttaatggagatttctgaggaagatgaaatttatctt
tatgagttagagagaccgtacgaagatggatctgatgacattttggttcctgtctatcat
atatctgatgattctacaaattcggcaaactcctatatgagttcacgcgattttggtcac
ccatttgtcctgcaattgtcagacaatgaagttactgatgcttcctttataagtgaaaag
ctcaaacttaaatatcagcaatttacaactttaaaaaacttaaaaaatattgactcgttg
gagtctttggaacttggccacgaagatgaacaagtgcaaaaaggtccgttggatgttgat
atggatcatagtcagacaccattgtttgaaatgagagttttccatgatcggtttgaaaaa
atccctaccggttggaacatgagtgtttctaacttgcctttgttaaccgaacgggataaa
aaggatttagaatcgacggtcgatcctttagatgctcattcaattgaggaagaagatgac
agtgagttcaaagacgttgcacccggttcatatcctgagccttcgaagagtaacgaaaac
accaagttgaccgcaaaggaaaatgatcgtttgcttattcagggtgacttgctggtgtgt
gagtggcctgaaaaatcctatcaatttgtatttagtgtggcaccttcttctcctcaaatg
ggacgttcattgtggctagaatcaaaaacaatattgtcggacaaaaaggatgattctgaa
gattctcgtaccattactttgaatgattgtttagatgagttcgaaaaaacggagcaactg
ggtgaagaagatccttggtactgtcctacatgcaaagaatttcgacaggctagtaaacaa
atggaaatttggagatgccccgaaattttgattttccatttgaagagatttagcagtgaa
agaaggtttagggataaaattgacgacttagttgaattccctattgacaatttagatatg
tctatgcggacgggtagctataaattgtccgaaaaagaaaatcctaaattaatttatgag
ctttatgctgtcgataatcactatggcggtcttggaggcggtcattacacagcatttgct
aaaaatcccgacaatggacaattttattgttttgatgattcacgggtcactcctgtatgt
cctgaagaaactgtcacctcagctgcatatctgttgttttatcgccgaaaaacaagctaa

DBGET integrated database retrieval system