KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1682.12cHelp
Entry
SPCC1682.12c      CDS       T00076                                 

Gene name
ubp16
Definition
ubiquitin C-terminal hydrolase Ubp16
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SPCC1682.12c (ubp16)
Peptidases [BR:spo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SPCC1682.12c (ubp16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(394883..396256)
Genome map
AA seq 457 aa AA seqDB search
MSLATLQGQSLDFAVKHSLDDLLKNPVRFRPAVVSSPSVPEGTYTVLNNPKQSTVSRKSF
SAPTSPTRNKRSGSSSQEYKKSSGTRGDGANDFVDEDPAFIPPARILFPEEKLSMEWDNI
MPNAPGLVNLGNTCFMNSVLQLMTQTPPLVQYLLSGQHSLSCRMNACVLCRMEQHVARAY
PNKGTKRASAFKPSGIQSMLKVISSHFRPYRQEDAHEFMRYLVDAWQKSCLQNHKNLDHP
SRETSVVHRIFGGYLRQQILCSVCKKPSNTYQALLDLSVDAKGSSLADSLKHFVHAEKLT
KQNKYRCENCKQLVDASKQMTIYRAPNILTIHFKRFTFNGFQSSKISKQISYPESFNLGP
YMSDPNCSCWYELIGVLVHAGGSTRSGHYYSFCKSSNGVWLKFDDDFVSNSSIDRVLNQQ
AYILQYKRKSTSSSKHKLNTENTVTKTSNKKRRKISF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttgctactttacaaggacagtcactagattttgcagtcaagcattcactagat
gatttgcttaaaaatcccgttcgctttcgtcccgcggttgtttcctcaccatcggttcct
gaaggtacttacactgtcttaaacaatccaaagcaatctactgttagccgtaagtcattt
tcagcgcctacttccccaactagaaacaaacgttctggttcttcttcccaggaatacaaa
aaatcttcaggaacaaggggtgatggagctaatgattttgtggatgaggatcctgctttt
atacctccggctcgcattctatttcccgaagaaaaattgtcgatggaatgggataatatc
atgcccaatgctccggggctcgtaaatctcggtaatacttgtttcatgaattcagtactt
cagttgatgactcaaactccaccgttggttcaatatcttttatccggtcaacattcttta
tcctgccgtatgaatgcatgtgtactctgtagaatggagcaacatgtcgcccgtgcctat
cccaacaaaggcaccaaacgagcttcggccttcaaaccttcaggtatacaaagtatgctc
aaagtaatttccagtcatttccgcccatatcgccaagaagatgctcatgaatttatgcga
tatttggttgatgcttggcaaaagtcttgtcttcaaaaccataaaaatcttgatcatcca
agcagggagacttcggtagtacacagaatttttggtggttacctacgccagcagattcta
tgctcagtttgtaaaaaaccttccaacacctaccaagctttacttgacttatctgtggat
gcgaagggctcctccttggcagattccttaaagcattttgtgcatgcagaaaaacttacc
aaacaaaacaaatatcgatgtgaaaattgtaagcaactggtggatgcgtccaagcaaatg
actatttatcgggcaccaaatattttaaccattcacttcaagcggttcacattcaacggt
ttccaatctagcaaaatcagtaagcaaatttcataccctgaatcattcaatctcggtccg
tatatgtcagatcccaattgttcttgttggtacgaattaattggggttcttgtacatgca
ggcggaagtacccgaagcggccattattattcgttttgcaaaagtagtaatggtgtttgg
cttaaatttgacgatgatttcgtttccaattccagtattgatcgagttttgaatcaacag
gcctatattttgcaatacaagaggaaatcaacttcatcgtctaaacacaagctaaacacc
gaaaacacggttaccaaaacttctaataaaaaacggagaaaaatttcattttaa

DBGET integrated database retrieval system