KEGG   Schizosaccharomyces pombe (fission yeast): SPCC16A11.12cHelp
Entry
SPCC16A11.12c     CDS       T00076                                 

Gene name
ubp1
Definition
ubiquitin C-terminal hydrolase Ubp1
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SPCC16A11.12c (ubp1)
Peptidases [BR:spo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SPCC16A11.12c (ubp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(join(889437..891666,891892..892211))
Genome map
AA seq 849 aa AA seqDB search
MASTATQNASTRYSQIWIDQPASLPFQDSINLIKEDKEKWKKEKTAFLIDYDWFEGYVDF
IYGEGDNPGPITQWRLLDEKNELKHSLEESIDYSIVSASLWHMLVEWFGLEGLAIERKVL
LVGLAAEQKPFVDIYPINFTLHVLFDPINGENTSYSPLYQIDEPYHSDEPYAFSFSRSDT
LRSLYKQVMEAFQISDGTSFRLWYLNKSNLSSRFVSLSEFNDQPAIALLSEYAVCMTIFE
IDIADGSLLLEFQHPNGEWLSDSITKEQNLTINKEIGLCGLYNLGNSCYMNSALQCMIHT
HELTKYFLSDSYEKDINYNNPLGMMGKVALSYASLLKMIHHTADMHSVSPSSFKFIIGEF
NTYFSGYRQQDSQEFIAFFLDGLHEDLNRIQIKPYFERPDLFDEHPLHVQRVANQCWDIH
TKRNDSIIVQLFQGMYKSTLECSICYQKSTAFDPFMYLTLPLPTSAKWRHKVVYVPPFGT
QSPVELYLELLMESTVIQMKFQATEKLQKMGLECGELTACDIYRGKVYKVLKNKDKISKK
IHKWDHVVLYGSTANGLTIPIVHGCKRPAMPGSYQSNDVFGFPLQLNVRSRNVLTNDLVK
EIVELYRVYAGIDVAIGTLQLGLKRMESKAGKWECIKEIEVKRFEIVEEEEIVIDDKTVI
MCLWNDQQYEKLFYNCEWIFEKIQFHMESITLEDCLLEFSKPEQLDLQDSWYCPGCKAFR
PATKRLEIWRLPKILVIHLNRFSGHGGDLRRRRKRRDLVVYPVFDLNLKQFLSPFIKDHE
WLSSQKSMLYDLYAVDNHHGFMSNGHYTAYARDASSQTFFKFDDTAICEIDPEDIVTSSA
YVLFYRAKN
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaactgctactcaaaacgcaagcactcgatattcccaaatttggatcgaccaa
cctgcttcattgccgttccaagattcgataaatttaattaaagaggataaagaaaaatgg
aaaaaagaaaaaactgcctttttaattgactatgactggttcgaaggatacgttgacttt
atatatggagaaggcgacaaccctggtcctataactcaatggaggctgctggatgaaaaa
aacgagcttaaacattctttggaggaatctattgattatagcattgtctctgcttcgcta
tggcatatgcttgttgagtggtttggattagaaggtctagctatagagcgaaaagttctt
ttggtaggattggctgctgagcaaaagccattcgtagatatctatcctataaactttact
ttgcacgttttattcgacccaataaacggtgaaaacacgagctattcaccattataccaa
attgatgaaccatatcatagtgatgaaccctatgcgtttagcttttcccgaagtgatacc
cttcggtctttgtacaaacaagtgatggaagctttccaaatatctgatggtacttctttc
cgtttatggtatctaaacaaaagtaatctatcttctaggtttgtaagtttgtcggagttc
aatgatcaacctgcgattgctttgctttccgagtatgctgtttgcatgactattttcgaa
atagatattgccgatggaagcttattgctcgagtttcaacatcctaacggagagtggtta
tctgactctataaccaaagagcaaaatttaacaataaataaagaaatcggactctgcggt
ctttacaatttgggtaattcatgctatatgaattctgcccttcaatgtatgatacataca
cacgaacttacaaaatattttcttagtgattcttatgaaaaggatattaattacaacaat
ccgttgggaatgatggggaaagttgccttgtcttatgctagtctactgaagatgatccat
catactgctgatatgcactcggtgtcacctagttctttcaaatttataattggcgagttt
aatacctatttttctggatatcgtcagcaagattctcaggaattcatcgcctttttctta
gacgggttacacgaagatttgaatcgaattcagataaaaccatactttgaaaggccagat
ttatttgacgaacacccattacatgttcagagagttgcaaatcaatgttgggatattcat
acaaaacgaaatgattccataattgttcagttgtttcaaggaatgtataaaagcacctta
gagtgctccatatgctatcaaaaatcaactgcgtttgatccgttcatgtatcttactctt
ccacttcctactagtgcaaaatggcgacacaaggtagtgtacgtcccgccatttggcaca
cagagtcctgtggaattgtatttggagcttctcatggaaagtacggtaatccaaatgaag
tttcaagctacggaaaagcttcaaaagatgggactcgaatgcggggaacttactgcttgt
gacatttatcggggaaaggtgtacaaggtattgaaaaataaagacaaaatatctaaaaaa
attcataaatgggatcatgttgtactttatggaagtactgcaaacggattaacaatacct
atcgtccatggatgtaaacgaccggcaatgcccggatcataccagtctaacgatgtgttt
ggatttcctttacaactcaacgtccgttctcgaaatgtactcacaaatgatttagtgaaa
gagattgtcgaactgtatcgagtttatgcaggcatagacgtagcaatcggaactcttcag
cttggactgaagcggatggaaagtaaggccgggaaatgggaatgcataaaggaaattgag
gttaaaaggtttgaaatagtggaggaagaggaaatcgttattgacgacaaaactgtaatt
atgtgtctatggaacgatcaacaatatgaaaagttattttataactgcgaatggatattt
gaaaaaattcagttccatatggagtccatcacccttgaagattgtttactggagttttcc
aagccagagcagcttgatttacaggattcctggtattgtcctgggtgtaaggcatttcga
ccggcaacaaaacggctggagatctggcgattgccaaaaatactagtcattcatttaaat
cgattcagcggccacggtggagatttgcggagaagacgtaaacgaagggatttagtagtt
tatccagtatttgatctcaatttgaagcaatttttgagtccatttataaaagatcatgag
tggctatcgtcacagaaatcgatgctttacgatttgtatgcagtggacaatcatcacggg
tttatgagtaatggtcattatactgcctatgcaagagatgcatcgagccaaacattcttt
aagtttgatgatacagctatttgtgaaatagatccggaggatattgtcacatcgtctgct
tatgtattgttttacagagcaaagaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system