KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1753.01cHelp
Entry
SPCC1753.01c      CDS       T00076                                 

Gene name
ssb2, rpa2, SPCC584.06c
Definition
single-stranded DNA binding protein Ssb2
Orthology
K10739  
replication factor A2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SPCC1753.01c (ssb2)
   03420 Nucleotide excision repair
    SPCC1753.01c (ssb2)
   03430 Mismatch repair
    SPCC1753.01c (ssb2)
   03440 Homologous recombination
    SPCC1753.01c (ssb2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(join(1540948..1541661,1541789..1541914))
Genome map
AA seq 279 aa AA seqDB search
MAYDAFGKPGYGPDFNSAFSPGMGGGAGFNEYDQSSQPSVDRQQGAGNKLRPVTIKQILN
ASQVHADAEFKIDGVEVGQVTFVGVLRNIHAQTTNTTYQIEDGTGMIEVRHWEHIDALSE
LATDTYVRVYGNIKIFSGKIYIASQYIRTIKDHNEVHFHFLEAIAVHLHFTQKANAVNGA
NAPGYGTSNALGYNNISSNGAANSLEQKLAEYSLTPAQMTVMQAIHSAPETNEGVHVRQL
AQSVGPGIDLTAVTDFLQQEGIIYTTIDENHFKSVLQDQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgatgcttttggcaagccgggctatggtcccgacttcaatagcgctttttct
ccaggaatgggaggaggcgctggatttaatgaatatgatcaatcgagccagcccagcgtc
gatagacaacaaggagctggaaataaattacgtcctgttaccattaagcaaattctcaat
gcctctcaagttcacgctgatgcagaattcaagatagatggcgttgaagtcggacaggtt
acttttgtaggagttttacggaacattcacgctcaaactacaaacacaacatatcaaata
gaagatggaacaggaatgattgaagtaaggcattgggaacacattgatgcgctatctgaa
cttgctacagacacctatgttcgtgtgtatggaaacatcaaaatattttctggaaaaatt
tacattgcttctcaatacatccgtacaattaaagaccataatgaagtccattttcatttc
cttgaagcaattgctgtacacctacatttcactcagaaagcaaatgctgtgaacggagcc
aacgctccaggctacggaacttccaacgcactaggctacaataacatttcttcaaatggt
gctgccaactctctggaacaaaaactagctgaatattcactaacccccgcacaaatgacc
gttatgcaagctatccatagtgcaccagagacgaatgaaggtgttcacgttagacaactt
gctcaaagcgtgggtcccggtatagaccttacggcggttactgattttcttcaacaagaa
ggaatcatctacacaacaattgatgaaaatcattttaaaagtgttttacaagaccaataa

DBGET integrated database retrieval system