KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1753.04Help
Entry
SPCC1753.04       CDS       T00076                                 

Gene name
tol1
Definition
3'(2'),5'-bisphosphate nucleotidase/inositol-1,4-bisphosphate 1-phosphatase (EC:3.1.3.57 3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SPCC1753.04 (tol1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SPCC1753.04 (tol1)
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SPCC1753.04 (tol1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:1550004..1551065
Genome map
AA seq 353 aa AA seqDB search
MSFDAEKQLAIAAVRRASYLTEKVFNQLIKEKSAAGALTKDDKSPVTIGDFGAQAIVISM
LKDAFPNDPIVGEEDSDFLRENTQTCSRVWELVQETIQHATEYKELGQIKSAEEMMSIID
QGSYHGGRNGRMWTLDPIDGTKGFLRGAQYAICLALIENGKPVVSAIGCPNLPYDFNQPE
TSPKGIIMSAVRNHGCFQYSLHNEKLEPVQVHMQDVQNTKDSKFCEGVEAGHSMQGTQEE
IAKYLGITRGPTKMDSQAKYASLARGDGDIYLRLPTKMTFEEKIWDHAGGSLLVEEAGGV
VSDMFGKPLDFGVGRTLKNNNGVIAAYKGIFEKVIEATAAVTSKDPHFQKVAQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagctttgatgccgaaaaacaattagctattgctgctgtgcgcagagctagctatttg
accgaaaaagtgtttaatcaacttatcaaggagaagagtgctgctggggcacttactaaa
gatgataaatcacctgtgactattggcgattttggtgctcaagctatcgtaatctctatg
ttaaaagatgcatttcccaatgatccaattgttggcgaagaggattccgactttttgaga
gaaaacacccaaacctgctctcgtgtttgggaattagttcaagaaactatccaacatgct
actgaatacaaagagcttggtcaaatcaagtcagctgaagaaatgatgagcattattgac
caaggatcatatcacggtggtcgcaatggtcgtatgtggactttggatcccattgatgga
actaaaggatttctacgtggtgcccagtatgctatttgtttagctttgattgagaatgga
aaacctgtggtaagtgccattggatgccctaatcttccatatgactttaatcagcccgag
acaagtcccaaaggtatcataatgtccgctgttcgtaaccatggttgcttccagtattct
ctccataacgaaaaattagaaccagttcaagtgcacatgcaagatgttcaaaacaccaag
gattcaaaattttgcgaaggagtagaggctggtcattcaatgcaaggaactcaagaagaa
attgcaaagtacttagggattactcgtggacctaccaagatggattctcaagccaaatac
gctagtcttgctcgtggtgatggtgacatctaccttcgtttaccaaccaaaatgacattt
gaagaaaaaatttgggatcatgctggtggttctcttcttgttgaagaggctggtggtgtt
gtttctgatatgtttggcaaacctttggactttggtgtaggaagaactcttaagaacaat
aacggtgttatagccgcctacaaaggtatttttgaaaaggtaattgaagctactgcagct
gtaacatctaaagaccctcactttcaaaaggtcgcccaataa

DBGET integrated database retrieval system