KEGG   Schizosaccharomyces pombe (fission yeast): SPCC188.08cHelp
Entry
SPCC188.08c       CDS       T00076                                 

Gene name
ubp5
Definition
ubiquitin C-terminal hydrolase Ubp5
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Enzymes [BR:spo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SPCC188.08c (ubp5)
Peptidases [BR:spo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SPCC188.08c (ubp5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(join(1488934..1492154,1492234..1492336,1492388..1492390))
Genome map
AA seq 1108 aa AA seqDB search
MVTGETLVDSQKSLINNDTLLNEKLKEDFEENVSIDVKIHEELRRALPDYEESGFQRFTW
HIKSWHELDRRAVSPQFAVGSRQFKITYFPQGTLQSAGFTSIFLEYIPSEEEKLSNKYGC
CCQFAFVISNPRKPSLSVANSAHCRFSPEIVDWGFTQFAELKKLLCRQAPDVPPIVEDGA
LLLTAYVRILKDPTGVLWHSFNDYDSKIATGYVGLKNQGATCYMNSLLQSLYIIHAFRRI
VYQIPTDSPQGKDSIAYALQRCFYNLQFMNEPVSTTELTKSFGWDSLDSFMQHDVQEFNR
VLQDNLERSMRDTKVENALTNLFVGKMKSYIACVNVNFESARSEDYWDIQLNVKGMKNLE
DSFRSYIQVETLEGDNCYFADTYGFQEAKKGVIFESFPPILHLQLKRFEYDFERDMMIKI
NDRYEFPLEFDAKAFLSPEADQSQNCEYVLYGVLVHSGDLHNGHYYALLKTEKDGPWYKY
DDTRVTRATLREVLEENYGGDYIMHPPFRSPVKLKRFMSAYMLLYLRKDKLDELMNPVSA
DEIPEHLKEALNPSIQLAELRRKERLESHLYTKVQLITPEFYSEHHEFDIADFGNAYKEE
TIPQFRIKKEAKFSEFIPIVAEKLGYPQECMRFWYVVKRHNCTVRVESPVNELNSTMEEV
KNVWNSQGEILRLYLEITPENELSSSLTHQNTGEWNAFIFVKYFDRKSQEISGCGTLHVN
KSDEIRSICPLLCERANLPKNTPLNIYEEIKPGMVDFLRLEKTFTQSELSTGDIICFEPC
RPSALEDDIVNSGFDSALKLYDFLSNKVLVLFRPRFIDQDSIIEFEMLLDRRIKYDDLCI
ELGQKLGIGADHIRLTTCNPLTYSAGMVVPNDSNITLYEILYSSEEEMPSNVIFYETMDV
SLSDLDRKRLVRLRWLVDGLANIELVEAYINKSGDINDLFGAVCERFPDSDLRKKKVRVY
EVFESRYHRDLSLRTLIRTINPAATLVGEVVPLDQLQLYPEEKIVQVHHFHKDIARIHGI
PFSFVIKPQEKFIDTKLRLAARTQYPESIFSVIKFCVVDFDNNRVVYLNDEDITYDVVEK
LNGTLALDRAKKDSKKPNILDRAIQMKN
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atggtcacgggtgaaactttagtagactcccaaaagtcactcattaataatgatacactc
ttgaatgagaaattaaaagaagactttgaagaaaatgtttccattgacgttaaaatacac
gaggaattgcgacgcgctttaccagattacgaagaaagcggttttcagagatttacttgg
catataaagagctggcatgagttggatcgaagagctgtgagtccccagtttgcagttggc
agtcggcaatttaaaattacctattttcctcaaggcactcttcaatcggctggatttact
tcaatatttttggaatatattccaagtgaagaagaaaaattgagcaataagtatggttgc
tgttgccaatttgcatttgtcatttcaaatccaaggaagccttctttgagcgttgccaac
tctgctcattgtcgattttcaccggagattgtggattggggcttcactcaatttgccgag
cttaaaaagctattatgccggcaagctcccgacgtccctccgattgttgaagatggcgcc
ttacttcttaccgcctatgttcgaattcttaaagatcctactggtgtactttggcactct
tttaatgactacgactctaaaatagccaccggatatgtaggcttaaagaaccaaggtgct
acctgctatatgaattctctcttacaatccctttacataatacatgcttttcgacgaatc
gtttatcaaattcctactgatagccctcaaggcaaggacagtattgcatacgcgttgcaa
cgctgtttctataaccttcaatttatgaatgagcccgtttccaccactgaacttactaaa
tcgtttggttgggattctttagattcgtttatgcaacatgacgtccaagagttcaaccgt
gttctacaggataacttagaacgaagcatgagggatactaaggttgaaaatgcacttacc
aacttatttgtcggtaaaatgaaaagttatattgcgtgcgtaaatgttaattttgaatct
gctcgttccgaagattattgggatattcagttaaatgtgaaaggaatgaaaaacctagag
gattcttttcgaagctatattcaagtcgagacgttagaaggtgataactgctattttgct
gatacttacggatttcaagaagccaaaaagggtgtaatttttgaatctttccctcctatt
ttacatttgcaattgaagcgatttgaatatgattttgaaagggacatgatgataaaaata
aacgatcgatacgagtttccattagagtttgatgctaaagcgtttttaagtcccgaagcc
gatcagtctcagaattgtgagtatgttctttacggtgtattggtccattctggtgatctt
cataatgggcattactatgcgttattaaaaacagaaaaagatggtccttggtataaatat
gatgacacgagagtcaccagggctactttgagagaagttttagaagagaactatggtggt
gattatatcatgcatcctccttttagatctcctgtcaaactaaaaagattcatgagtgca
tacatgcttttatatttgcgcaaagataaattagatgaactcatgaatccagtttctgct
gatgaaattccagaacatttgaaagaagctttgaatcccagtatccaacttgctgaactt
cgcagaaaagaaagactagagagccatctgtatactaaagtgcaattaatcactccagaa
ttttacagtgaacatcatgaatttgatattgccgattttggaaatgcttacaaagaagaa
actatacctcaatttcgcattaaaaaggaggccaagttttctgagtttatcccaattgtt
gctgaaaaactgggctatcctcaggaatgtatgcgtttttggtatgttgtcaaaagacat
aactgtaccgtacgcgtggaatctcctgtgaacgaactgaattctacaatggaggaagtg
aaaaacgtatggaattcacaaggtgaaatccttcgcttgtatttagaaatcaccccagaa
aatgagctaagctcttctcttacacaccaaaatactggagaatggaatgccttcattttt
gttaaatattttgatcgaaaatcgcaagagatttctggatgtggaactctccacgttaat
aaaagcgatgaaattcgttcaatatgtccgttactatgcgaaagagcaaatttaccgaag
aacaccccgttaaatatatatgaagaaattaaaccggggatggttgattttcttcggtta
gaaaaaacgtttacacaaagtgaattgagtactggtgatattatatgttttgaaccatgc
cgcccatctgccttagaagatgatatcgttaactcaggttttgatagtgcccttaagtta
tacgactttttgagcaataaggttttggtattatttcgcccgcgatttattgaccaagat
agcattattgaatttgaaatgctgctcgaccgaagaattaaatatgatgatctatgtatt
gaacttggtcaaaaacttggtattggtgctgatcatattcgacttaccacttgcaatcca
ttgacttattctgctgggatggtagtccctaacgattcaaatattacactgtatgaaatt
ttgtacagctcggaggaagaaatgccatctaatgttattttctatgagactatggacgta
agtctttcagacttggatcgtaagcgtttagtaagattacgctggctagttgacggatta
gctaatatcgaattagtcgaagcgtacatcaataaatctggggatatcaacgacctattt
ggtgctgtttgtgaacgatttccggatagcgatttgcgaaagaaaaaagttagggtatat
gaggtttttgagagtagatatcatcgtgatctttcgttgaggactcttataaggaccatt
aatcctgccgctactttagttggtgaagtcgtacccttagaccagctgcagctatacccc
gaagagaaaattgtacaggtccatcatttccacaaggatattgcaagaattcatggaatt
ccgtttagttttgtcattaaaccccaggaaaaattcatcgatacaaaactacgtcttgca
gctcgcacacagtatccagaaagcattttcagcgttattaaattctgtgtggtggatttt
gataacaatagagttgtctatttgaatgatgaagacattacatatgatgttgttgaaaaa
ctaaacggtacattggctttggatcgtgctaagaaagatagtaagaagccgaatatactc
gaccgtgctattcagatgaaaaattag

DBGET integrated database retrieval system