KEGG   Schizosaccharomyces pombe (fission yeast): SPCC191.07Help
Entry
SPCC191.07        CDS       T00076                                 

Gene name
cyc1
Definition
cytochrome c (predicted)
Orthology
K08738  
cytochrome c
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SPCC191.07 (cyc1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:1714735..1715064
Genome map
AA seq 109 aa AA seqDB search
MPYAPGDEKKGASLFKTRCAQCHTVEKGGANKVGPNLHGVFGRKTGQAEGFSYTEANRDK
GITWDEETLFAYLENPKKYIPGTKMAFAGFKKPADRNNVITYLKKATSE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgccttacgctcctggagacgaaaagaagggtgcttccctgttcaagactcgttgcgct
caatgtcataccgttgaaaaaggcggcgccaacaaggtcggtcccaatttgcacggtgta
tttggccgtaagaccggtcaagctgagggtttctcttacaccgaagccaatcgcgataag
ggtattacttgggatgaagaaactcttttcgcctacctcgaaaaccccaagaagtatatc
cccggtactaagatggcctttgctggcttcaagaaaccggctgatcgtaacaacgtcatt
acgtatttgaagaaggccacctctgagtaa

DBGET integrated database retrieval system