KEGG   Schizosaccharomyces pombe (fission yeast): SPCC191.11Help
Entry
SPCC191.11        CDS       T00076                                 

Gene name
inv1
Definition
(RefSeq) beta-fructofuranosidase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SPCC191.11 (inv1)
   00500 Starch and sucrose metabolism
    SPCC191.11 (inv1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SPCC191.11 (inv1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PomBase: 
UniProt: 
Position
III:1724306..1726051
Genome map
AA seq 581 aa AA seqDB search
MFLKYILASGICLVSLLSSTNAAPRHLYVKRYPVIYNASNITEVSNSTTVPPPPFVNTTA
PNGTCLGNYNEYLPSGYYNATDRPKIHFTPSSGFMNDPNGLVYTGGVYHMFFQYSPKTLT
AGEVHWGHTVSKDLIHWENYPIAIYPDEHENGVLSLPFSGSAVVDVHNSSGLFSNDTIPE
ERIVLIYTDHWTGVAERQAIAYTTDGGYTFKKYSGNPVLDINSLQFRDPKVIWDFDANRW
VMIVAMSQNYGIAFYSSYDLIHWTELSVFSTSGYLGLQYECPGMARVPVEGTDEYKWVLF
ISINPGAPLGGSVVQYFVGDWNGTNFVPDDGQTRFVDLGKDFYASALYHSSSANADVIGV
GWASNWQYTNQAPTQVFRSAMTVARKFTLRDVPQNPMTNLTSLIQTPLNVSLLRDETLFT
APVINSSSSLSGSPITLPSNTAFEFNVTLSINYTEGCTTGYCLGRIIIDSDDPYRLQSIS
VDVDFAASTLVINRAKAQMGWFNSLFTPSFANDIYIYGNVTLYGIVDNGLLELYVNNGEK
TYTNDFFFLQGATPGQISFAAFQGVSFNNVTVTPLKTIWNC
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgaaatatattttagctagtggcatttgcctcgtctctctcttatcatctaca
aacgcggctccccgtcacttatatgtaaaacgttatcctgtcatttataatgcttccaac
atcactgaagtcagcaattctaccaccgttcctcctcctccattcgtaaatacaacggcc
cctaatgggacttgtttgggtaactataacgagtatcttccttcaggatattacaatgct
accgatcgtcccaaaattcattttactccttcttccggtttcatgaatgatccaaacgga
ttggtatatactggcggcgtctatcacatgttcttccaatattcaccaaaaactctaaca
gccggcgaagttcattggggtcacacagtttccaaggatttaatccattgggagaattat
cctattgccatctaccccgatgaacatgaaaacggagttttgtccctcccatttagtggc
agtgcagtcgtcgatgttcataattcttccggtctcttttccaacgacaccattccggaa
gagcgcattgttttaatttataccgatcattggactggtgttgctgagcgtcaggctatt
gcgtataccactgatggtggatatactttcaaaaaatattcaggaaatcccgttcttgac
attaattcacttcaattccgcgaccccaaggtaatatgggatttcgatgctaatcgttgg
gtgatgattgtagctatgtctcaaaattatggaattgccttttattcctcctatgacttg
attcactggaccgagttatctgttttctccacttctggttatttggggttgcaatatgaa
tgccctggaatggctcgtgtgcccgttgaaggcaccgatgaatacaaatgggtactcttc
atctccatcaatcctggcgctccattgggaggatccgttgtccaatactttgttggcgat
tggaatggtacaaacttcgtccccgatgatggccaaactagattcgtagacttgggtaag
gacttttacgccagcgctttgtatcactcgtcttccgccaatgccgatgttattggagtt
ggatgggctagcaactggcaatacaccaaccaagctcctactcaagttttccgcagtgct
atgacagttgcacgaaaattcactcttcgcgacgttcctcagaaccccatgaccaacctt
acttctctcattcaaaccccattgaatgtttctctcttacgagatgaaacactatttacc
gcacccgttatcaatagttcaagtagtctttcgggctctccgattactcttccaagcaat
accgcattcgagttcaatgtcacactcagtatcaattacacagaaggctgcacaacagga
tattgtctggggcgtattatcattgattctgatgatccatacagattacaatccatctcc
gtggacgttgattttgcagctagcactttagtcattaatcgtgccaaagctcagatggga
tggtttaattcacttttcacgccttcttttgccaacgatatttacatttatggaaacgta
actttgtatggtattgttgacaatggattgcttgaactgtatgtcaataatggcgaaaaa
acttacactaatgactttttcttccttcaaggagcaacacctggacagatcagcttcgct
gctttccaaggcgtttctttcaataatgttaccgttacgccattaaagactatctggaat
tgctaa

DBGET integrated database retrieval system