KEGG   Schizosaccharomyces pombe (fission yeast): SPCC24B10.21Help
Entry
SPCC24B10.21      CDS       T00076                                 

Gene name
tpi1, tpi
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPCC24B10.21 (tpi1)
   01230 Biosynthesis of amino acids
    SPCC24B10.21 (tpi1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPCC24B10.21 (tpi1)
   00051 Fructose and mannose metabolism
    SPCC24B10.21 (tpi1)
   00562 Inositol phosphate metabolism
    SPCC24B10.21 (tpi1)
Enzymes [BR:spo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPCC24B10.21 (tpi1)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPCC24B10.21 (tpi1)
  Exosomal proteins of bladder cancer cells
   SPCC24B10.21 (tpi1)
  Exosomal proteins of melanoma cells
   SPCC24B10.21 (tpi1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:939945..940694
Genome map
AA seq 249 aa AA seqDB search
MARKFFVGGNFKMNGSLESMKTIIEGLNTTKLNVGDVETVIFPQNMYLITTRQQVKKDIG
VGAQNVFDKKNGAYTGENSAQSLIDAGITYTLTGHSERRTIFKESDEFVADKTKFALEQG
LTVVACIGETLAEREANETINVVVRQLNAIADKVQNWSKIVIAYEPVWAIGTGKTATPEQ
AQEVHAEIRKWATNKLGASVAEGLRVIYGGSVNGGNCKEFLKFHDIDGFLVGGASLKPEF
HNIVNVHSL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaaattctttgtcggtggtaactttaagatgaatggctctttggagtccatg
aagactattattgagggtttgaacaccaccaagcttaacgttggtgatgtcgaaactgtc
atcttccctcaaaacatgtacctcatcaccacccgccaacaagtcaagaaggatattggc
gttggtgcccaaaacgtcttcgacaagaagaacggtgcctacactggtgagaacagtgct
caatctttgattgatgctggtattacctacactttgactggtcactccgagcgtcgtacc
atcttcaaggagtctgacgagttcgttgccgacaagaccaagtttgcccttgaacaaggt
cttactgtcgttgcctgcattggtgagactttggccgagcgtgaggctaacgagaccatc
aacgttgttgttcgtcaattgaacgccatcgctgacaaggtccagaactggtccaagatt
gtcattgcttatgagcctgtctgggccattggtactggtaagactgccacccctgagcaa
gctcaagaggttcacgctgagatccgcaagtgggctaccaacaagcttggtgcatctgtt
gccgagggtctccgtgtcatctacggtggttccgttaacggtggtaactgcaaggagttc
ctcaagttccacgatattgacggtttcttggttggcggtgcttctctcaagcctgaattc
cacaacattgttaatgttcacagcctttaa

DBGET integrated database retrieval system