KEGG   Schizosaccharomyces pombe (fission yeast): SPCC24B10.21Help
Entry
SPCC24B10.21      CDS       T00076                                 

Gene name
tpi1, tpi
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00010  Glycolysis / Gluconeogenesis
spo00051  Fructose and mannose metabolism
spo00562  Inositol phosphate metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01130  Biosynthesis of antibiotics
spo01200  Carbon metabolism
spo01230  Biosynthesis of amino acids
Module
spo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPCC24B10.21 (tpi1)
   00051 Fructose and mannose metabolism
    SPCC24B10.21 (tpi1)
   00562 Inositol phosphate metabolism
    SPCC24B10.21 (tpi1)
Enzymes [BR:spo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPCC24B10.21 (tpi1)
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPCC24B10.21 (tpi1)
  Exosomal proteins of bladder cancer cells
   SPCC24B10.21 (tpi1)
  Exosomal proteins of melanoma cells
   SPCC24B10.21 (tpi1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 2538729
NCBI-ProteinID: NP_588024
PomBase: SPCC24B10.21
UniProt: P07669
Position
III:939945..940694
Genome map
AA seq 249 aa AA seqDB search
MARKFFVGGNFKMNGSLESMKTIIEGLNTTKLNVGDVETVIFPQNMYLITTRQQVKKDIG
VGAQNVFDKKNGAYTGENSAQSLIDAGITYTLTGHSERRTIFKESDEFVADKTKFALEQG
LTVVACIGETLAEREANETINVVVRQLNAIADKVQNWSKIVIAYEPVWAIGTGKTATPEQ
AQEVHAEIRKWATNKLGASVAEGLRVIYGGSVNGGNCKEFLKFHDIDGFLVGGASLKPEF
HNIVNVHSL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaaattctttgtcggtggtaactttaagatgaatggctctttggagtccatg
aagactattattgagggtttgaacaccaccaagcttaacgttggtgatgtcgaaactgtc
atcttccctcaaaacatgtacctcatcaccacccgccaacaagtcaagaaggatattggc
gttggtgcccaaaacgtcttcgacaagaagaacggtgcctacactggtgagaacagtgct
caatctttgattgatgctggtattacctacactttgactggtcactccgagcgtcgtacc
atcttcaaggagtctgacgagttcgttgccgacaagaccaagtttgcccttgaacaaggt
cttactgtcgttgcctgcattggtgagactttggccgagcgtgaggctaacgagaccatc
aacgttgttgttcgtcaattgaacgccatcgctgacaaggtccagaactggtccaagatt
gtcattgcttatgagcctgtctgggccattggtactggtaagactgccacccctgagcaa
gctcaagaggttcacgctgagatccgcaagtgggctaccaacaagcttggtgcatctgtt
gccgagggtctccgtgtcatctacggtggttccgttaacggtggtaactgcaaggagttc
ctcaagttccacgatattgacggtttcttggttggcggtgcttctctcaagcctgaattc
cacaacattgttaatgttcacagcctttaa

DBGET integrated database retrieval system