KEGG   Schizosaccharomyces pombe (fission yeast): SPCC24B10.21Help
Entry
SPCC24B10.21      CDS       T00076                                 

Gene name
tpi1, tpi
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:spo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:spo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:spo00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:spo00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:spo00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:939945..940694
Genome map
AA seq 249 aa AA seqDB search
MARKFFVGGNFKMNGSLESMKTIIEGLNTTKLNVGDVETVIFPQNMYLITTRQQVKKDIG
VGAQNVFDKKNGAYTGENSAQSLIDAGITYTLTGHSERRTIFKESDEFVADKTKFALEQG
LTVVACIGETLAEREANETINVVVRQLNAIADKVQNWSKIVIAYEPVWAIGTGKTATPEQ
AQEVHAEIRKWATNKLGASVAEGLRVIYGGSVNGGNCKEFLKFHDIDGFLVGGASLKPEF
HNIVNVHSL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaaattctttgtcggtggtaactttaagatgaatggctctttggagtccatg
aagactattattgagggtttgaacaccaccaagcttaacgttggtgatgtcgaaactgtc
atcttccctcaaaacatgtacctcatcaccacccgccaacaagtcaagaaggatattggc
gttggtgcccaaaacgtcttcgacaagaagaacggtgcctacactggtgagaacagtgct
caatctttgattgatgctggtattacctacactttgactggtcactccgagcgtcgtacc
atcttcaaggagtctgacgagttcgttgccgacaagaccaagtttgcccttgaacaaggt
cttactgtcgttgcctgcattggtgagactttggccgagcgtgaggctaacgagaccatc
aacgttgttgttcgtcaattgaacgccatcgctgacaaggtccagaactggtccaagatt
gtcattgcttatgagcctgtctgggccattggtactggtaagactgccacccctgagcaa
gctcaagaggttcacgctgagatccgcaagtgggctaccaacaagcttggtgcatctgtt
gccgagggtctccgtgtcatctacggtggttccgttaacggtggtaactgcaaggagttc
ctcaagttccacgatattgacggtttcttggttggcggtgcttctctcaagcctgaattc
cacaacattgttaatgttcacagcctttaa

DBGET integrated database retrieval system