KEGG   Schizosaccharomyces pombe (fission yeast): SPCC290.03cHelp
Entry
SPCC290.03c       CDS       T00076                                 

Gene name
nup186
Definition
nucleoporin Nup186
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    SPCC290.03c (nup186)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(join(1994322..1994581,1994633..1999316))
Genome map
AA seq 1647 aa AA seqDB search
MDVWESQHFSALLYLLQCIESNPSNPNVSSRLLIQCLESYSKDFLKFLALDPANANSRKK
LESGEVELGGVINKVNEQFIQLSLTLSTQLNLDEIQCASLLQRGIEASQNLDRTPVQAAL
YFFFLAREQLLECLESLTRVVGLKDLESDISTALKSYLQSLCENGNNLVKTCIDTIPILD
NKVSEILKSEAGGQILGVSEVVDFQEFIRLSHEAHVAELETISVILYQLAKVDLFQNSHF
ESLLVMLRKYDSPNKNAVLILPTLYAFIDKVLEVEYLPDQKVQLRSNSVEILQKIHQAII
QSPSQDWRSSQFKNILGIWWVTRLNATCKQIEKVPSFIDYETTIKNAANEIIQNGVFSDM
ITLLVYPFRQSETEGMEWAFAFKSRSRITVNWSLIRPFIASIIFSELRSFAQAFVSYMPD
ILKTLRLLEEDRYLTNTTYPTSIPGEQIEEYFPFEEFYYLLSSIYTYNVSWISDFWDDIE
SDMYGFLTWSMGSQIPGIITAFTLLLASLCKNTTSASKIYELFSEPIPEVGHLESLMITS
PSWSYIFNVFRYYISHLKPVQTVVTSSGLARVHTDPSEIDTDSALILQAYILLFSSVVRQ
DAQIASTFCENQDLNPIATLFELLECRLPDSVRICIVRALESLAHLSTGSFNNALWTALD
NWFVSSVLFDVDGGLAPMSIPAISKRSLTKPVTSCGPLLNNIRRLTVNLEMKISFVNLLT
SLTRNKSELNVNLTFPENLGASYRTPGVQPYVDYVVETFVASSTQWRLMRDVGSIRLQYA
CLQYMLAVLDGLNIDLLLYSRILSSKVRDNLQNNNLHVYLTRHPAISLLEALYTESVYSG
LFDLVEYGFDQLEDVSVPKTIVITVSASLCILRNVLSLQRVLFKNVVPYIAELGISKYIL
DLTISRRAYKEVFMTRISSIVHLALLVGSRHKCFLRSAIEILSYLVDAEGFMNKRNPDEN
KLLCSIIRTANESKRIIFGFIRTFESQFLTLLSTNDESSLILKLLLNNLKQSGGVYSLAL
LILGFDISSTNVITLRDQPGYVGSRVSLMNSLLDFIEGRTIVNGIWETPVIMVQALEIVA
FLCSCPLTSEVTLSVIRARPGLLVKMVDGEPILTQQVIQNLGGFSSEEVSMVSRCIRSRT
QIMNMLATEIHYAASVGQNKYLNEYVASLIRTNEKTHSTELSQKESGFKILEFMDILRID
PQSITFELPNIPGFNLNMFITRFDRGHSDFQFDTERVLKIYRLFFEAEMTSLGGSAEEKY
SWLEQQNSKLKELAQRLNTFNAHVVLLQDIHGCLTAWARLTGLLVDDCNEVISDVHFDDF
IWEVLRLVLPGVTVHNLGTQGTVSVTSSVIETILPHALRRIGALKPEELGKSTYFMEGIH
DVIVGLLKGIQCQQSDESIRENLYGSLLSILTVFQKHTSANGGDKVDPVFKDAFQKLITP
NLLTSQFFDVLTKDALYTNGSCWELSVIILNFLHHVSPDISTHLYKYYLRRNFVSSFIDA
FSRAFSELLSSNKDVLEVLSGLEAGQCLLITFAQNKLTVHSVLTFDYIKLMVQMLLQLCK
QGGIQYLKPPVQRLMIQLLQIFILVLMRVTLKEISNKDKLLLQSIFLLSRKLQDSVQTGA
DQALSPEMNTVKKYVETISRLLDLYRD
NT seq 4944 nt NT seq  +upstreamnt  +downstreamnt
atggatgtctgggaatctcagcacttttccgctcttttatacttattgcagtgtatcgaa
agtaatcccagcaatccaaatgtttcttctcgtttgttaatacaatgtcttgaatcctac
tcaaaggattttctaaaatttttggctttagatccagctaatgctaattctcgcaaaaaa
ttggaatccggtgaagttgaattaggcggtgtaatcaacaaagtcaatgagcagttcatc
cagttgtctcttactctctctactcagttaaatttggatgaaattcaatgcgcaagttta
ctacaacgtggcattgaagcgtctcaaaatcttgatcgaactcccgttcaagctgcgttg
tatttcttttttctagctcgagaacaactcttggaatgtttagaatcattaacaagggtt
gtaggcttaaaagacttggagtcggacatttctacagccctgaagtcttatcttcagagc
ttatgcgaaaatggcaataatttggtgaagacttgcattgacacaatacctattttagat
aataaagtctcagagatattgaaaagtgaggcgggcggccaaatacttggagtatctgaa
gttgttgattttcaagaatttattagactctctcatgaggcacatgtcgcggagttggaa
actatttctgttatactttaccaactcgcaaaagtagacttgtttcaaaattctcatttt
gaaagccttttggtcatgttaaggaagtacgactccccaaataaaaatgcagttttgatt
ttacccactttatatgctttcatagacaaggtattagaagttgaatatcttcctgatcag
aaagtacagttgagatctaattctgtcgagattcttcagaaaatccaccaggcaattatt
caatcaccttcccaagattggcgttcatctcaattcaaaaatattctcggcatatggtgg
gttacccgtcttaatgcgacatgcaaacagattgaaaaagttccttcttttatagattac
gagaccacgataaaaaacgctgcaaatgaaatcattcaaaatggtgttttttctgatatg
attacactgcttgtatatccctttcgtcaatcagaaactgaaggtatggaatgggcgttt
gcgttcaaatcccgttctagaatcaccgttaactggtctcttattcgaccgtttattgca
tccattattttttcggagcttcgttcttttgcacaagcatttgtcagttatatgcccgat
atactaaaaacccttcgcttgttggaagaagaccgctacttaacaaacactacttaccct
acttctatccctggtgaacaaattgaagaatactttccatttgaagaattctattattta
ctatcatctatttacacctataatgtttcctggatatcagatttttgggacgatattgaa
agtgatatgtatggatttctcacttggtcaatgggatctcagattcctggaatcattact
gcatttacacttttacttgcctcattatgcaagaataccactagtgcatctaaaatatac
gaattattctcagagcccatacccgaagttggacatttagaaagtttaatgataactagt
ccaagttggtcttatatctttaatgtttttcgttactacatatcgcatttaaagccagta
caaacggttgtcacttcatctggtctcgcacgagtacatacagatccaagtgaaattgac
actgactctgcattgattttacaagcctatatcttgttattctcttctgtggtgaggcaa
gatgctcaaattgcaagcacattttgtgaaaatcaagatttaaatcctattgctactctg
tttgaacttttagaatgtcggctacctgattcagttagaatttgtatcgttcgagctttg
gaatccttagcccatttgtcgactggttcattcaacaacgctttatggacagctcttgat
aattggtttgtaagctcggtattgtttgatgttgatggtgggttagcacctatgtcaatt
cctgccatttctaagcgatcattaaccaagccagttacttcctgtggcccattattaaat
aatatacgaagacttactgtgaatttggaaatgaagatttcatttgttaacctccttacg
tcgttgactcgtaataagagtgaactcaatgttaatttaacgtttcctgagaatttgggt
gcttcctatcgtacaccaggagttcaaccttatgttgattatgtcgtggaaacttttgtg
gcttcttctactcagtggaggttaatgcgtgatgttggatccatcaggttacagtatgca
tgtttacaatatatgctcgccgtccttgatggtctcaacattgatttgttattatactct
cgaattcttagcagtaaggtcagggataatcttcaaaataacaatttgcatgtttatttg
actagacatcctgcaatatctcttctcgaagctctttacaccgaaagtgtatattccggt
ttgtttgacttggttgaatacggctttgaccaattggaagatgtttctgttcccaagacg
atcgttataacggtttcggcgtctctttgtatattacgcaatgttctatctctccagcgt
gttttgttcaagaacgtggttccttatatagctgagctaggaattagcaagtatattttg
gatttgactatatctagaagagcttataaagaggtgtttatgactcgaatttcttctatc
gtacatcttgcgttattagttggttctcgccataaatgttttcttcgctcagccatagag
atattgagttatctggtagatgcagaaggtttcatgaacaaaagaaatcctgatgaaaat
aagctgttgtgctcaatcattagaacagctaacgaaagcaaacgtataatttttggcttt
attcgcacgtttgaaagccaatttttaactttgttatctaccaatgatgaatcttccttg
attctaaaattgcttttgaataatcttaaacagagtggtggagtttattcacttgctcta
ttgatcttaggatttgatatatcctcgacaaatgtgattacattgcgagatcagcctggc
tacgttggctctcgggtttctctcatgaattccctgctagactttattgaaggaaggaca
attgttaatggtatttgggaaactcctgttattatggttcaagctttagagattgtagcc
tttttatgttcttgtcctctgacttctgaagttacgttatctgttattcgagctagacct
gggttgcttgttaaaatggtagatggtgagcctatacttacccagcaagtcattcagaat
cttggcggattttcttcggaagaagtaagtatggtatccagatgcatccgttctcgtaca
cagataatgaacatgctggcgaccgaaatacattatgctgcctctgtaggtcaaaacaaa
tacttaaatgaatatgtggcatctcttataagaacaaatgaaaaaacacatagcacagag
ctttctcaaaaagagtctggtttcaaaatcttagaatttatggatatattacgaattgac
cctcaaagcataacatttgagctacccaatatccctggttttaatttgaatatgtttatt
acacgattcgatcgtggtcacagtgattttcaatttgacactgaacgtgtactcaagatt
taccgtttgttttttgaagcagaaatgactagtctggggggttcggctgaggaaaaatac
tcttggttagagcaacagaattcaaagttgaaagaattggctcagagactaaacaccttt
aatgcacacgttgtacttttgcaagatatccatggatgtctaactgcatgggcaagacta
actggtcttttggttgacgattgtaatgaggtgatatcggatgtacattttgatgatttc
atctgggaggtgcttcgacttgtgctgcctggtgttactgtgcataatctcggtactcaa
ggtacagtatctgtgacgagttcagtcattgagacaattttaccacatgctctaaggaga
atcggagctttaaaacctgaagagcttggcaaatctacttattttatggagggtatacat
gatgttattgtaggcttattgaaaggtattcagtgccaacaatccgatgaaagcatccgt
gaaaatctttatggatcattgttaagtattttgaccgtatttcaaaaacatacatctgct
aatggaggcgataaggttgatccagttttcaaggatgcattccaaaaactaattacacct
aacttacttaccagtcaattttttgatgttttgactaaagacgccttatataccaatggc
tcctgctgggaactttcagtcattatattaaatttcttgcatcatgtgtcccctgatata
tctactcatctatacaagtattatctacgtcggaactttgtaagttcctttatcgatgct
ttttcacgagccttttcagagttgttgtcctctaataaagatgtattggaagttctgagt
ggtcttgaagccggccaatgtcttctaattacatttgcacaaaacaaacttacggtccac
tctgttcttacttttgactacattaaattgatggttcagatgttattacaattgtgcaaa
caaggtggaattcagtaccttaagcctcctgtccagcgtttaatgattcagttactgcaa
atttttatcttggttttaatgagagttacgctgaaagagatttcgaacaaggataagctc
cttctccagtctattttcttactttcgcgtaaattgcaagattctgttcagactggtgct
gatcaagctctcagtccggaaatgaatacggtcaaaaaatatgttgaaaccataagtcgg
ctcttggatctttatagagattga

DBGET integrated database retrieval system