KEGG   Schizosaccharomyces pombe (fission yeast): SPCC31H12.05cHelp
Entry
SPCC31H12.05c     CDS       T00076                                 

Gene name
sds21
Definition
serine/threonine protein phosphatase Sds21 (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    SPCC31H12.05c (sds21)
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    SPCC31H12.05c (sds21)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     SPCC31H12.05c (sds21)
Protein phosphatases and associated proteins [BR:spo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     SPCC31H12.05c (sds21)
Transcription machinery [BR:spo03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     SPCC31H12.05c (sds21)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     SPCC31H12.05c (sds21)
Spliceosome [BR:spo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    SPCC31H12.05c (sds21)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(join(628996..629094,629146..629847,630218..630342,630401..630443))
Genome map
AA seq 322 aa AA seqDB search
MDYDIDAIIEKLVKARNGKPSKQVQLSDAEIRYLCTTSRSIFLSQPMLLELEAPLKICGD
IHGQYSDLLRLFEYGGYPPDANYLFLGDYVDRGKQSLEVICLLFAYKIKYPENFFLLRGN
HEFASINRIYGFYDECKRRYSIKLWKTFTDCFNCMPVAAVIDEKIFCMHGGLSPDLNSLD
QIQRIIRPTDIPDTGLLCDLVWSDPEKDLTGWGENDRGVSYTFGADVVSRFLQKHDLDLI
CRAHQVVEDGYEFFGKRQLVTIFSAPNYCGEFDNVGAMMSVNEDLLCSFQILKPAEKRQR
VSQSSIKESKSATNSLKKSKNN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggattatgatattgatgcgattattgaaaaacttgtaaaagcccgtaatggcaaacct
agtaagcaggttcagttatctgatgcagaaattagatacctatgtactacttctcgttct
atttttttgagtcagcctatgctgttggagttggaggctcccttaaagatttgcggtgat
attcatggacaatattcggatttacttcgattgtttgagtatggaggatatcctcctgat
gcgaactacctttttcttggtgattatgttgatcgcggcaaacagagtttggaagtcatt
tgtcttttatttgcttataaaatcaaatatcccgaaaatttcttcttacttcgtggcaat
catgagtttgccagcatcaatcgaatttatggtttctacgatgagtgtaagcgtcggtat
agcataaagttgtggaaaacctttaccgattgcttcaactgtatgccagttgctgcggtt
attgatgaaaaaatattttgtatgcatggtggtctttcaccagacttgaattctctggat
cagattcagcgtatcattcgtccaaccgacattcccgacacaggactgctttgtgattta
gtttggtccgaccctgaaaaggacttgacgggatggggtgagaacgatcgcggtgtatct
tatacattcggtgccgatgtggtgagccggtttttgcaaaagcacgacttggatttaatt
tgtcgagctcaccaagtcgtcgaagatggttacgagttttttggcaaacgtcaactggtt
actattttcagcgctcccaactattgtggtgaatttgataatgtgggagccatgatgagt
gttaatgaggatttgctttgtagctttcagatattgaaacctgcagaaaagcggcaacgt
gtaagccagtcttctataaaagaatcgaaatctgcgacgaacagtttgaagaaatccaaa
aataattag

DBGET integrated database retrieval system