KEGG   Schizosaccharomyces pombe (fission yeast): SPCC4B3.04cHelp
Entry
SPCC4B3.04c       CDS       T00076                                 

Gene name
nte1
Definition
lysophospholipase (predicted)
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:spo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPCC4B3.04c (nte1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SPCC4B3.04c (nte1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:join(1168730..1168929,1168979..1169153,1169211..1172786)
Genome map
AA seq 1316 aa AA seqDB search
MDITDRILQNRIVSKVIFFVLRSVTLSLVSVTRFSLFLLSFATITVPKWAYKIVTYSLTI
QFNFKSLLFLFFVSICVVILVVRYRYLNKYARLPHEAPIKEAKLGPDTNIRPSEPRIGFQ
NYLDEFLSAISIFGYLEKPVFVELARHIRTQRVAEGNTIYLGEQSSFILVVDGCFQVFTA
PEKDSAEVVEEAGQPEYRLLTEVSNGAPLSSFFTVLELFTELIPEATSKENPFKSTTSSL
RPGSSTTTEAGANNASKPHMPQPKKARIIAKAKIDTTIAVIPANAFHHLVHKFPNSSAQI
VQVILTRFQRVTFSTGYEYLGLSDAIFSIEKNFNSLTAYELPNYIRSDIIDDFKKEAMSE
HLSQASNESFIVLRSKGAQSRLSNQYFSKAFDKEHGNFVSDIDRSTANAGDLLSSTNPHS
TLLSTSVGPLRKFPLNRSYSREVGDYDISASFRDGLLQCIFKSLGVFNYELKEDNDDLCT
ENDSSEGDSDSLKKVDFLGQIAMMSATDREEVKSSIVVSTKKSTILEFAKEIEIIFYKKG
TTIVRQGDHADGLYYIIDGFLDATCPSKLTFSTSYDTDLGMHSFMIKPGGIVNYQACVSN
YRSFINVTARSDVLVGFLPRSCLERIIDQEPLISLTIAKRLISLVPSLLLKLDFAVGWIH
LNPDQVVYEKNDPSDCVYVVLNGRLRSIEDERGSARTQVDYFNEYGKGDSVGELEMLLNN
RRSSTLFAIRDSELAKIPETLFNALSLSHPAVGLQLSKIIANRMNLLLNNKSMDGMQHQP
HEKHSIRTLAIVPSSSTGLLILFSQKLTSVLSVMGKSVKVLRQSSVLEHLGKHAFSRMGR
FKLSSYLSDLEDKYDILIYVADSGVGSAWLQTCIRQADCIYILAEADQNPNIGEYEQHLI
AMKSTARKELVLLHPERFCPSGLTRLWLKERPWVYAHHHVQLRIGLDNEISQNNEAKVFL
NIIRAKVQNLHYGFRKYIDWKHLHPVYQANRAQDSDFARLARRICGKAIALVLGGGGARG
ISQIGILYALEEAGIPFDIIGGTSIGAFNGGLYAWEADLVPMFGRAKKFCGRMANLWRFV
LDVTYPQAAYTTGHEFNRGIWKTFGEIHIEDFWLPFYANTTNITHSRMDIHSSGYAWRYI
RASMSLAGLVPPMLSDSGDMLLDGGYMDNLTVSHMQSLGASSIFAIDVGSEDSREPMHYG
DTVSGVWALISRWIPFIPKTSFPSLAEIQSRLTYVTSVATGEKVKSMPGCFYMRPPVKDF
PTLEFGSFEKIYNVGYNYGKEYVEKLKTSHKLDDILSPRDTSKRHPKFLSSRRNSL
NT seq 3951 nt NT seq  +upstreamnt  +downstreamnt
atggacatcacagatcgtattttgcaaaacagaatagtttccaaagttattttttttgtt
ttgcgatctgtaactcttagtttggtgtctgtaacaaggttttctttatttctgttatcg
tttgctaccattactgttccaaaatgggcgtataaaatagtcacatactcacttacgata
caattcaactttaaatcattgttgttcttgtttttcgtttcaatatgtgtcgtaatcctt
gtcgttcgatatagatatctcaataaatatgcaaggcttcctcatgaagcacctattaag
gaagccaaattgggtcctgataccaacataaggccgtcagaaccaagaattggatttcag
aattatctcgacgaatttctaagtgctatcagtatttttggttacctggagaaacctgtt
tttgttgagttagctagacatatccgaacccaacgtgtagctgaaggtaatacaatttac
cttggcgaacaatcatcctttatactggtggttgatggttgctttcaagtatttactgcg
ccagaaaaggactccgcagaggttgttgaagaagctggtcaaccagaatatagactacta
acagaggtatccaatggtgctccactttcaagctttttcacagttctggaactttttaca
gaattaattcccgaagctactagtaaagagaatccgttcaagtctaccactagttcacta
agacctggcagtagcactactacagaagctggtgctaacaatgctagcaaaccgcatatg
ccacaacccaaaaaagctcgtattattgccaaagcgaaaattgataccactattgccgtc
attcctgctaatgcatttcatcacttggttcacaaatttcctaactccagtgctcaaatt
gtccaagtaattttaactcgatttcaacgtgtaactttttcaacagggtatgaatattta
ggcttatctgatgccatattcagtattgagaaaaattttaattctctcactgcgtatgag
ttacctaattatattcgcagcgatattattgatgatttcaagaaggaagcaatgtctgaa
catctttcccaagcatcaaatgagagtttcatagttttaagaagcaaaggagctcagtct
agactttccaatcaatactttagcaaagcttttgacaaagagcatggtaactttgtttcc
gatattgatcgttcaacagcaaatgcaggtgatttactttcttccacaaatcctcattca
acacttctttcaacctcggtgggtccattgagaaaatttcctctaaatcgatcatattct
agagaagttggagattacgatatctcagcctctttccgagacggcttattacagtgcatc
tttaagtctttgggtgttttcaattatgaactaaaagaagacaacgatgatctgtgcact
gaaaatgactcatctgaaggtgattctgattctttgaagaaggtggattttcttggccaa
attgcgatgatgagtgctacggatagagaagaagtaaagagttcaatcgtagttagtacg
aagaaatctactatccttgaatttgctaaagagattgaaatcatcttttacaaaaaaggg
acgactattgttagacaaggggatcatgcagatggcctgtactatattattgacggattt
ttggatgctacttgcccttccaaattaacttttagtacctcttatgatacagatttagga
atgcattcttttatgattaaacctggtggaatcgttaattatcaggcttgtgtttccaat
tatcgttctttcattaacgttacggctagatcagatgttctcgttggatttctacctcgt
tcttgtttggaaaggataattgatcaagagccattaatatccctaacaattgcaaaaagg
cttatctcattagtaccatcattacttttgaaattagattttgctgtcggttggatacat
cttaaccctgatcaagttgtttatgaaaagaacgatcccagtgattgcgtttatgtggtt
ttaaacggacgtttgcgttcaattgaggatgaacgcggaagcgctagaactcaagtggat
tactttaacgagtatggaaaaggagacagtgtgggagaactagaaatgctattaaataat
cgcagaagtagtaccctttttgccattcgtgattctgagttggctaaaattcccgaaacc
ctttttaatgctttgtctttaagtcatcctgctgttggtttacagttgtcaaaaattatt
gcaaacagaatgaatttgcttcttaataacaaatctatggatggaatgcaacatcaacca
catgaaaaacacagcattagaactctagctatagtcccttcttcatccacaggtttgctc
attcttttctctcaaaagcttacttctgtgctgtctgttatgggaaagtcggtgaaggta
cttagacaatcttcggttttagagcatttgggaaaacatgcatttagtcgtatgggcaga
tttaagctttcaagttacctaagtgatctcgaagacaaatatgatatactaatatacgtc
gctgattctggtgtgggcagcgcttggttgcaaacttgcatcaggcaggctgactgtatc
tacattcttgctgaagccgatcaaaatccaaatattggagaatatgagcaacatcttatt
gctatgaagtcaactgctagaaaggagttagtcttgcttcaccccgaaagattttgccca
tcaggcttgacaagactatggttgaaagaacgaccttgggtttatgcccatcaccatgtc
caactacgcattggacttgataacgaaatatcccaaaataatgaggctaaggtattttta
aacattatacgagcaaaagtacaaaatttgcattatggctttcgaaagtacattgattgg
aagcacttgcatccggtgtaccaagcgaatcgtgcccaagacagcgattttgctcgtcta
gccagaaggatttgtggaaaagccattgcacttgttcttggtgggggtggagctagaggc
atttcgcaaatcggcattctatatgcgttagaggaagctggaattccatttgacattatt
ggaggaaccagtattggagcctttaatggtggtctgtacgcatgggaggcggatctggtc
ccgatgtttggtagagcaaagaaattttgcggacgtatggcgaacctatggcgatttgta
ctggatgtaacgtatccacaagcagcgtataccactgggcatgaatttaatcgtggtata
tggaagacttttggggagatacatattgaagacttttggttaccgttctacgccaatacc
actaatattacccattctcgcatggacatccactcgagtggttatgcgtggagatacatt
agggctagtatgtcgcttgcaggcctcgtccctcccatgctttcggatagtggggacatg
cttttagacggtggttatatggataacttgacagtctctcatatgcaatcattaggtgcg
agctcaatctttgccattgatgtaggtagtgaagattcccgcgagccaatgcattatgga
gacacagtgtccggtgtttgggccctgatttctcgatggattccatttattcctaaaaca
tcgtttccttcattggctgaaattcaatctcgccttacttatgttactagtgttgcgaca
ggtgaaaaggtaaaatcgatgcctggatgcttttacatgcgacctcctgttaaagatttt
ccgactttggaatttggaagtttcgaaaaaatctataacgtcggctacaattacggaaaa
gagtatgtcgaaaaattgaagacatctcacaaattagatgatattctttctccacgcgat
acatccaagcgtcatcccaagtttttgtcttcaagacgtaattctttgtaa

DBGET integrated database retrieval system