KEGG   Schizosaccharomyces pombe (fission yeast): SPCC622.09Help
Entry
SPCC622.09        CDS       T00076                                 

Gene name
htb1
Definition
histone H2B Htb1
Orthology
K11252  
histone H2B
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
Exosome [BR:spo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPCC622.09 (htb1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:1412484..1412864
Genome map
AA seq 126 aa AA seqDB search
MSAAEKKPASKAPAGKAPRDTMKSADKKRGKNRKETYSSYIYKVLKQVHPDTGISNQAMR
ILNSFVNDIFERIATEASKLAAYNKKSTISSREIQTAVRLILPGELAKHAVTEGTKSVTK
YSSSAQ
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgctgaaaagaaacccgcttccaaggctcccgccggtaaggctcctagggat
accatgaagtctgctgataagaagcgtggtaaaaacagaaaggaaacttattcatcctat
atttacaaggtgttgaagcaagttcaccctgatactggtatttccaaccaagccatgcgt
atcttgaactctttcgtcaacgatatttttgagcgtattgccactgaggcttccaagctt
gctgcttacaacaagaagtccactatttcttcccgtgaaatccagactgctgttcgtttg
attcttcccggtgagttagccaagcacgccgttaccgaaggtaccaaatccgtcaccaag
tattcttcttctgctcagtaa

DBGET integrated database retrieval system