KEGG   Schizosaccharomyces pombe (fission yeast): SPCC622.09Help
Entry
SPCC622.09        CDS       T00076                                 

Gene name
htb1
Definition
histone H2B Htb1
Orthology
K11252  
histone H2B
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:1412484..1412864
Genome map
AA seq 126 aa AA seqDB search
MSAAEKKPASKAPAGKAPRDTMKSADKKRGKNRKETYSSYIYKVLKQVHPDTGISNQAMR
ILNSFVNDIFERIATEASKLAAYNKKSTISSREIQTAVRLILPGELAKHAVTEGTKSVTK
YSSSAQ
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgctgaaaagaaacccgcttccaaggctcccgccggtaaggctcctagggat
accatgaagtctgctgataagaagcgtggtaaaaacagaaaggaaacttattcatcctat
atttacaaggtgttgaagcaagttcaccctgatactggtatttccaaccaagccatgcgt
atcttgaactctttcgtcaacgatatttttgagcgtattgccactgaggcttccaagctt
gctgcttacaacaagaagtccactatttcttcccgtgaaatccagactgctgttcgtttg
attcttcccggtgagttagccaagcacgccgttaccgaaggtaccaaatccgtcaccaag
tattcttcttctgctcagtaa

DBGET integrated database retrieval system