KEGG   Schizosaccharomyces pombe (fission yeast): SPCC777.10cHelp
Entry
SPCC777.10c       CDS       T00076                                 

Gene name
ubc12
Definition
NEDD8-conjugating enzyme Ubc12
Orthology
K10579  
ubiquitin-conjugating enzyme E2 M [EC:6.3.2.19]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    SPCC777.10c (ubc12)
Enzymes [BR:spo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     SPCC777.10c (ubc12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PomBase: 
UniProt: 
Position
III:complement(join(1615079..1615188,1615436..1615583,1615695..1615783,1615866..1615961,1616028..1616118))
Genome map
AA seq 177 aa AA seqDB search
MRKIWELKKKEAQKEKNASGISPAQIRIQKDVTDLEIPSTMSTSWPDPIKLNVLHLEIRP
DEGYYKGGKFKFRIQIDDNYPHDPPKVKCLNKIYHPNIDIEGNVCLNILRQDWNPVLNLN
SILVGLQFLFLSPNAEDPLNKEAAADLHKDPQGFASRVRTAMKGGLVNGISFDNVMA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatttgggaattaaaaaagaaagaagctcaaaaagagaaaaatgcgtcaggg
attagtccagcacaaatccgaatccaaaaagacgttacagatttagaaatcccatctacg
atgtctacaagctggccagatcctataaaattgaacgtgctacatttagaaatccggcct
gacgaagggtattacaagggtgggaaatttaaatttcgaatccaaatcgacgataattat
cctcatgatcctcctaaggttaaatgtctaaacaaaatctatcacccaaatatcgatatt
gagggaaacgtatgcctcaatattctgcgtcaggattggaatccagtgttgaatttgaat
tctattttggttggattgcaatttttattcttgtcaccaaacgcagaagatccactcaac
aaagaggcggcggctgatttgcataaagaccctcaaggatttgcatctcgtgtgcgtaca
gccatgaaaggtggtcttgtgaatggaatttcttttgacaatgtcatggcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system